Property Summary

NCBI Gene PubMed Count 36
PubMed Score 53.95
PubTator Score 27.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Alzheimer Disease 83 0.0 0.0
Disease Target Count
Alzheimer's disease 658
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Male infertility 206 4.068 2.0
Infertility 188 3.83 1.9
Clonorchiasis 13 3.272 1.6

Expression

Gene RIF (18)

AA Sequence

MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMV      1 - 70
SVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVV     71 - 140
DNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNEND    141 - 210
YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIP    211 - 280
ASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE    281 - 350
DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK                351 - 408
//

Text Mined References (37)

PMID Year Title