Property Summary

NCBI Gene PubMed Count 35
PubMed Score 53.65
PubTator Score 27.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

Synonym

Accession O14556 B2RC82 O60823 Q6JTT9 Q9HCU6
Symbols GAPD2
GAPDS
HSD-35
GAPDH-2
HEL-S-278

Gene

PANTHER Protein Class (2)

PDB

3H9E   3PFW   5C7L   5C7O  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
S.cerevisiae OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (17)

PMID Text
26660717 This result implies that GAPDHS participates in specific signal-transduction pathways.
25936797 Structural basis for the NAD binding cooperativity and catalytic characteristics of sperm-specific glyceraldehyde-3-phosphate dehydrogenase
23675907 Data indicate that the positive expression of studied genes fertilization rate for GAPDHS positive subset was 66%, ACR - 71%, SPATA22 - 68%, MND1 - 70%, pregnancy rates were 8%, 6%, 18% and 36% respectively.
23306140 GAPDS protein was expressed in both Sertoli cells and elongated sperms. The expression of GAPDS gradually increased with age in the epididymis.
23026046 the expression of GAPDS in melanoma cells may facilitate glycolysis and prevent the induction of apoptosis.
21995946 The chaperonin TRiC was shown to assist an ATP-dependent refolding of recombinant forms of GAPDS.
21269272 Structure and kinetic characterization of human sperm-specific glyceraldehyde-3-phosphate dehydrogenase, GAPDS.
20880607 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20833277 Data suggest that high stability of the sperm-specific GAPDS is of importance for the efficiency of fertilization.
20828617 Human his-GAPDHS expressed in baculovirus-infected insect cells is homotetrameric.
More...

AA Sequence

MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAEVEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMV      1 - 70
SVARELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVV     71 - 140
DNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNEND    141 - 210
YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIP    211 - 280
ASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE    281 - 350
DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK                351 - 408
//

Text Mined References (36)

PMID Year Title
26660717 2016 The proline-rich region of glyceraldehyde-3-phosphate dehydrogenase from human sperm may bind SH3 domains, as revealed by a bioinformatic study of low-complexity protein segments.
25936797 2015 Structural basis for the NAD binding cooperativity and catalytic characteristics of sperm-specific glyceraldehyde-3-phosphate dehydrogenase.
23675907 2013 Expression analysis of MND1/GAJ, SPATA22, GAPDHS and ACR genes in testicular biopsies from non-obstructive azoospermia (NOA) patients.
23306140 2013 Location and characterization of GAPDS in male reproduction.
23026046 2012 Sperm-specific glyceraldehyde-3-phosphate dehydrogenase is expressed in melanoma cells.
21995946 2011 Chaperonin TRiC assists the refolding of sperm-specific glyceraldehyde-3-phosphate dehydrogenase.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269272 2011 Structure and kinetic characterization of human sperm-specific glyceraldehyde-3-phosphate dehydrogenase, GAPDS.
20880607 2012 Exploration of 16 candidate genes identifies the association of IDE with Alzheimer's disease in Han Chinese.
20833277 2010 Recombinant human sperm-specific glyceraldehyde-3-phosphate dehydrogenase: structural basis for enhanced stability.
More...