Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.97
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 6.3e-05
osteosarcoma 7950 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 2.7
Type 2 diabetes mellitus 272 0.0 0.7
Disease Target Count Z-score Confidence
Influenza 142 3.0 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.275 1.4e-03
ovarian cancer 1.100 6.3e-05

Protein-protein Interaction (4)

Gene RIF (2)

AA Sequence

MAEFLDDQETRLCDNCKKEIPVFNFTIHEIHCQRNIGMCPTCKEPFPKSDMETHMAAEHCQVTCKCNKKL      1 - 70
EKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGE     71 - 140
EKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSI    141 - 210
QNNLFEEQERQERNRGQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLS    211 - 280
DIKGAADEIMLPCEFCEELYPEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPDVIFQNFLQQAASNQL    281 - 350
DSLMGLSNSHPVEESIIIPCEFCGVQLEEEVLFHHQDQCDQRPATATNHVTEGIPRLDSQPQETSPELPR    351 - 420
RRVRHQGDLSSGYLDDTKQETANGPTSCLPPSRPINNMTATYNQLSRSTSGPRPGCQPSSPCVPKLSNSD    421 - 490
SQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENIVPSFSPGPSGRYGASGRSEGGRNSRVTPAAANYRS    491 - 560
RTAKAKPSKQQGAGDAEEEEEE                                                    561 - 582
//

Text Mined References (27)

PMID Year Title