Property Summary

NCBI Gene PubMed Count 122
Grant Count 55
R01 Count 18
Funding $6,550,536.81
PubMed Score 364.49
PubTator Score 185.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession O14497 D3DPL1 Q53FK9 Q5T0W1 Q5T0W2 Q5T0W3 Q8NFD6 Q96T89 Q9BY33 Q9HBJ5 Q9UPZ1 ARID domain-containing protein 1A
Symbols ELD
B120
CSS2
OSA1
P270
hELD
BM029
MRD14
hOSA1
BAF250
C1orf4
BAF250a
SMARCF1

Gene

PDB

1RYU  

Gene RIF (95)

PMID Text
26953344 loss of ARID1A protein expression caused by inactivating mutations reactivates TERT transcriptional activity and confers a survival advantage of tumor cells by maintaining their telomeres.
26945423 The loss of ARID1A was correlated with late-stage and endometriosis-associated ovarian clear cell carcinoma. ARID1A expression may predict the risk of recurrence.
26904685 All cases with ARID1A expression are overlapped with H2B high expression. Among 15 cases with ARID1A and H2B coexpression, 13 are invasive ductal carcinoma and 2 are mucinous carcinoma. Our results indicate that ARID1A gene may be involved in carcinogenesis of some subtypes of breast cancer.
26826411 Complete or partial loss of ARID1A expression is considered an independent poor prognostic factor in patients with gastric cancer.
26716708 Arid1A role in genome-wide transcriptional regulation by SWI/SNF complexes.
26614907 Identification of this undescribed functional NLS within ARID1A contributes vital insights to rationalize the impact of ARID1A missense mutations observed in patient tumors.
26572704 we focus on the relationships of ARID1A mutations with ovarian and endometrial cancers[review]
26378916 ARID1A positively regulates Klf15 expression with PGR to inhibit epithelial proliferation at peri-implantation. Our results suggest that Arid1a has a critical role in modulating epithelial proliferation which is a critical requisite for fertility
26334097 analysis of ARID1A, CDH1, cMET and PIK3CA expression and target-related microRNA expression in gastric cancer
26303865 The findings demonstrated a correlation between ARID1A expression and adenomatous differentiation of uterine squamous cell carcinomas. Therefore, ARID1A gene may have a role in the pathogenesis of cervical adenosquamous carcinomas.
More...

AA Sequence

MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLG      1 - 70
KELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAA     71 - 140
AALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNH    141 - 210
QYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPS    211 - 280
AAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAAS    281 - 350
GGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQ    351 - 420
PYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPP    421 - 490
SQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPY    491 - 560
QQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL    561 - 630
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPV    631 - 700
GSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSA    701 - 770
LSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQ    771 - 840
MHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQN    841 - 910
RPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATK    911 - 980
MNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLD    981 - 1050
LYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAA   1051 - 1120
ADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDA   1121 - 1190
FNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY   1191 - 1260
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQ   1261 - 1330
QQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQP   1331 - 1400
QQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGT   1401 - 1470
NAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRAN   1471 - 1540
HEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSG   1541 - 1610
MKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGL   1611 - 1680
LAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRF   1681 - 1750
SKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKN   1751 - 1820
DPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPG   1821 - 1890
TTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPH   1891 - 1960
SKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLT   1961 - 2030
YEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQ   2031 - 2100
DPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVL   2101 - 2170
LANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLA   2171 - 2240
LAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS                            2241 - 2285
//

Text Mined References (138)

PMID Year Title
26953344 2016 Inactivating ARID1A Tumor Suppressor Enhances TERT Transcription and Maintains Telomere Length in Cancer Cells.
26945423 2016 Clinicopathologic Significance of HNF-1?, AIRD1A, and PIK3CA Expression in Ovarian Clear Cell Carcinoma: A Tissue Microarray Study of 130 Cases.
26904685 2016 Expressing Status and Correlation of ARID1A and Histone H2B on Breast Cancer.
26826411 2016 Various ARID1A expression patterns and their clinical significance in gastric cancers.
26716708 2015 Genome-Wide Transcriptional Regulation Mediated by Biochemically Distinct SWI/SNF Complexes.
26614907 2016 Identification and functional characterization of a novel bipartite nuclear localization sequence in ARID1A.
26572704 2016 ARID1A gene mutation in ovarian and endometrial cancers (Review).
26378916 2015 ARID1A Is Essential for Endometrial Function during Early Pregnancy.
26334097 2015 Deregulation of ARID1A, CDH1, cMET and PIK3CA and target-related microRNA expression in gastric cancer.
26303865 2015 Differences in the ARID-1 alpha expressions in squamous and adenosquamous carcinomas of uterine cervix.
More...