Property Summary

NCBI Gene PubMed Count 32
PubMed Score 61.02
PubTator Score 34.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.37369535170215E-18
lung adenocarcinoma 2714 6.26942159073188E-17
group 4 medulloblastoma 1875 1.05394073944865E-9
tuberculosis 1563 3.51190062749081E-8
malignant mesothelioma 3163 3.76908549610517E-7
breast carcinoma 1614 8.12228508947969E-6
medulloblastoma, large-cell 6234 8.14203561523982E-6
lung cancer 4473 8.87696485346632E-6
psoriasis 6685 4.34056303543181E-5
nephrosclerosis 329 6.63504908669719E-5
acute quadriplegic myopathy 1157 1.40143573698849E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.42765659036947E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.790904331431E-4
Atopic dermatitis 944 3.8536407514725E-4
ductal carcinoma in situ 1745 5.79239821288397E-4
pilocytic astrocytoma 3086 6.58259365575656E-4
permanent atrial fibrillation 44 7.57158550423852E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 9.47331862961189E-4
adrenocortical carcinoma 1427 0.00102830209615087
atypical teratoid / rhabdoid tumor 4369 0.00103758519824711
invasive ductal carcinoma 2950 0.00116372490499357
osteosarcoma 7933 0.00133165376787419
ovarian cancer 8492 0.00181980579617058
glioblastoma 5572 0.00496180479745459
posterior fossa group B ependymoma 1530 0.00576169890011994
Pick disease 1893 0.00625903665788911
colon cancer 1475 0.0077477732851834
Breast cancer 3099 0.00999605758796989
Down syndrome 548 0.0122086238730003
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0141496663003463
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0145533778092377
astrocytoma 1493 0.0314092096299571
pancreatic cancer 2300 0.0329339180940878
mucosa-associated lymphoid tissue lymphoma 480 0.0342439004282853
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0

Expression

Synonym

Accession O14495 B2R651 D3DQ52 Q5U0F7 Q96GW0 Q99782
Symbols LPP3
VCIP
Dri42
PAP2B
PPAP2B

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG

 CSPA Cell Line (1)

Gene RIF (11)

PMID Text
26034042 Mechanosensitive PPAP2B plays a critical role in promoting anti-inflammatory phenotype and maintaining vascular integrity of endothelial monolayer under atheroprotective flow.
24518713 study concludes polymorphisms of TGM5, PPAP2B and PSMA4 are not major contributors tonon-small cell lung cancer susceptibility in never-smoking hinese population, this primarily can be attributed to the significantly distinct genetic background of Asian populations from western populations
23508853 PPAP2B gene rearrangement is associated with lipomas.
21569306 expression of LPP3 in human colon tumor (SW480) cells potentiated tumor growth via increased beta-catenin stability and CYCLIN-D1 synthesis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20123964 Results identify a key role for LPP3 in orchestrating PTEN-mediated beta-catenin/LEF-1 signaling in EC migration, cell-cell adhesion, and formation of branching point structures.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18215144 endogenous LPP2 and LPP3 form homo- and hetero-oligomers, which differ in their subcellular localization and which may confer differing spatial regulation of phosphatidic acid and sphingosine 1-phosphate signalling
17555747 LPP3 acted as an ecto-phosphatase on FTY720-P.
17005594 LPP1 and LPP3 are distributed in distinct lipid rafts that may provide unique microenvironments defining their non-redundant physiological functions.
More...

AA Sequence

MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND      1 - 70
ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS     71 - 140
QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL    141 - 210
VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT    211 - 280
KTTLSLPAPAIRKEILSPVDIIDRNNHHNMM                                           281 - 311
//

Text Mined References (36)

PMID Year Title
26034042 2015 Mechanosensitive PPAP2B Regulates Endothelial Responses to Atherorelevant Hemodynamic Forces.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24518713 Association between TGM5, PPAP2B and PSMA4 polymorphisms and NSCLC in never-smoking Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23508853 2013 Identification of PPAP2B as a novel recurrent translocation partner gene of HMGA2 in lipomas.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21846871 2011 A genome-wide association study in europeans and South asians identifies 5 new Loci for coronary artery disease.
21569306 2011 Lipid phosphate phosphatase-3 regulates tumor growth via ?-catenin and CYCLIN-D1 signaling.
More...