Property Summary

NCBI Gene PubMed Count 34
PubMed Score 65.05
PubTator Score 34.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Coronary artery disease 268 3.036 1.5
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 2.4

Expression

  Differential Expression (34)

Disease log2 FC p
acute quadriplegic myopathy 1.434 1.4e-04
adrenocortical carcinoma -1.282 8.8e-03
astrocytic glioma 1.300 1.9e-02
Astrocytoma, Pilocytic 1.300 4.3e-04
Atopic dermatitis -1.600 2.2e-03
atypical teratoid / rhabdoid tumor -1.600 1.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.001 2.2e-02
Breast cancer -1.400 1.0e-02
breast carcinoma -1.800 8.1e-06
colon cancer -2.800 7.7e-03
Down syndrome 1.700 1.2e-02
ductal carcinoma in situ -1.700 5.8e-04
glioblastoma 1.300 5.0e-03
group 3 medulloblastoma -3.600 3.1e-05
intraductal papillary-mucinous adenoma (... -2.600 1.4e-04
intraductal papillary-mucinous carcinoma... -2.600 1.8e-04
intraductal papillary-mucinous neoplasm ... -2.000 1.4e-02
invasive ductal carcinoma -1.585 1.2e-03
lung adenocarcinoma -2.000 6.3e-17
lung cancer -2.800 9.6e-05
malignant mesothelioma -1.400 3.8e-07
medulloblastoma, large-cell -1.400 2.4e-03
mucosa-associated lymphoid tissue lympho... 2.083 3.4e-02
nephrosclerosis 1.296 6.6e-05
non-small cell lung cancer -1.219 8.4e-12
osteosarcoma 2.992 1.3e-03
ovarian cancer 1.800 1.8e-03
pancreatic cancer 1.200 3.3e-02
pancreatic ductal adenocarcinoma liver m... -1.804 9.5e-04
permanent atrial fibrillation -1.100 7.6e-04
Pick disease 1.300 6.3e-03
posterior fossa group B ependymoma -1.100 5.8e-03
psoriasis -1.200 1.8e-04
tuberculosis -1.200 7.1e-06

 CSPA Cell Line (1)

Gene RIF (13)

AA Sequence

MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND      1 - 70
ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS     71 - 140
QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL    141 - 210
VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT    211 - 280
KTTLSLPAPAIRKEILSPVDIIDRNNHHNMM                                           281 - 311
//

Text Mined References (38)

PMID Year Title