Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.30
PubTator Score 14.20

Knowledge Summary

Patent

No data available

Synonym

Accession O14492 A6ND74
Symbols APS

Gene

PDB

1Q2H  

Gene RIF (7)

PMID Text
25496667 Genome-wide shRNA screening identifies SH2B2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24162774 Genome-wide shRNA screening identifies SH2B2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23190452 Studies indicate that insulin receptor (IR) and IGF Type 1 Receptor (IGFR) have been identified as important partners of Grb10/14 and SH2B1/B2 adaptors.
20237496 Observational study of gene-disease association. (HuGE Navigator)
15737992 N-terminal residues distal to the phosphotyrosine directly contact residues of the four-helix bundle of the TKB domain of the adapter protein APS
12400014 We present here a novel stimulatory mechanism of Vav3 in which APS directly relieves the autoinhibitory CH domain and furthermore enhances its tyrosine phosphorylation by Lck.
12101115 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNGAGPGPAAAAPVPVPVPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGASFSRHFAANFL      1 - 70
DVFGEEVRRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSEDVSTHAATKARVRKGFSLRNM     71 - 140
SLCVVDGVRDMWHRRASPEPDAAAAPRTAEPRDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADDAAA    141 - 210
GSGGSAQWQKCRLLLRRAVAEERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVEN    211 - 280
GAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTELSCTRGGCLASRVASCSCELLTDAVDLPRPPETTA    281 - 350
VGAVVTAPHSRGRDAVRESLIHVPLETFLQTLESPGGSGSDSNNTGEQGAETDPEAEPELELSDYPWFHG    351 - 420
TLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDM    421 - 490
LRHFHTHPIPLESGGSADITLRSYVRAQDPPPEPGPTPPAAPASPACWSDSPGQHYFSSLAAAACPPASP    491 - 560
SDAAGASSSSASSSSAASGPAPPRPVEGQLSARSRSNSAERLLEAVAATAAEEPPEAAPGRARAVENQYS    561 - 630
FY                                                                        631 - 632
//

Text Mined References (18)

PMID Year Title
23190452 2013 Regulation of insulin and type 1 insulin-like growth factor signaling and action by the Grb10/14 and SH2B1/B2 adaptor proteins.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19293402 2009 Lnk inhibits myeloproliferative disorder-associated JAK2 mutant, JAK2V617F.
18273061 2008 Structural basis for a novel intrapeptidyl H-bond and reverse binding of c-Cbl-TKB domain substrates.
16141217 2005 Cross-talk between the two divergent insulin signaling pathways is revealed by the protein kinase B (Akt)-mediated phosphorylation of adapter protein APS on serine 588.
16129412 2005 Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.
15737992 2005 Structural characterization of a novel Cbl phosphotyrosine recognition motif in the APS family of adapter proteins.
15378031 2004 A phenylalanine zipper mediates APS dimerization.
15231829 2004 Asb6, an adipocyte-specific ankyrin and SOCS box protein, interacts with APS to enable recruitment of elongins B and C to the insulin receptor signaling complex.
12853948 2003 The DNA sequence of human chromosome 7.
More...