Property Summary

NCBI Gene PubMed Count 34
Grant Count 64
R01 Count 44
Funding $12,937,865.98
PubMed Score 27.64
PubTator Score 32.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
primitive neuroectodermal tumor 1.300 0.000
lung cancer 1.800 0.000
lung carcinoma 1.200 0.000

Synonym

Accession O00512 Q5T489 B-cell lymphoma 9 protein
Symbols LGS

Gene

PDB

2VP7   2VPB   2VPD   2VPE   2VPG   2GL7   3SL9  

 MGI Term (1)

Gene RIF (21)

PMID Text
26844272 BCL9/9L-beta-catenin Signaling is Associated With Poor Outcome in Colorectal Cancer
26494551 findings indicate that BCL9 most likely does not harbor a common genetic variant that can increase the risk for schizophrenia in the Japanese population
26384318 BCL9 is a molecular driver of DCIS invasive progression.
26081897 PCDH10 antagonized MM cell proliferation via the downregulation of Wnt/beta-catenin/BCL-9 signaling, whereas PCDH10 repressed the expression of AKT to promote the expression of GSK3beta and then to restrain the activation of beta-catenin
24599134 MiR-30-5p downregulation occurs as a result of interaction between multiple myeloma cells and bone marrow stromal cells, which in turn enhances expression of BCL9.
24419084 By beta-catenin's association with LEF1 and BCL9-2/B9L.
23382809 we detected five SNPs in the first two genes/loci - BCL9 and C9orf5 - strongly associated with negative symptoms of schizophrenia
22914623 Inhibition of the BCL9-beta-catenin interaction and selectively suppresses oncogenic Wnt transcription.
22024689 growth factor induced proliferation mediates a neutralizing response by significantly increasing miR-30c-2* which reduces BCL9 expression and cell proliferation in SKOV-3 and OVCAR-3 cells
21383261 These findings indicate that common variations in the BCL9 gene confer risk of schizophrenia and may also be associated with bipolar disorder and major depressive disorder in the Chinese Han population.
More...

AA Sequence

MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQPSPCDSKSGG      1 - 70
HTPKALPGPGGSMGLKNGAGNGAKGKGKRERSISADSFDQRDPGTPNDDSDIKECNSADHIKSQDSQHTP     71 - 140
HSMTPSNATAPRSSTPSHGQTTATEPTPAQKTPAKVVYVFSTEMANKAAEAVLKGQVETIVSFHIQNISN    141 - 210
NKTERSTAPLNTQISALRNDPKPLPQQPPAPANQDQNSSQNTRLQPTPPIPAPAPKPAAPPRPLDRESPG    211 - 280
VENKLIPSVGSPASSTPLPPDGTGPNSTPNNRAVTPVSQGSNSSSADPKAPPPPPVSSGEPPTLGENPDG    281 - 350
LSQEQLEHRERSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGP    351 - 420
GPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFYEEKRRKQEQV    421 - 490
VVQQCSLQDMMVHQHGPRGVVRGPPPPYQMTPSEGWAPGGTEPFSDGINMPHSLPPRGMAPHPNMPGSQM    491 - 560
RLPGFAGMINSEMEGPNVPNPASRPGLSGVSWPDDVPKIPDGRNFPPGQGIFSGPGRGERFPNPQGLSEE    561 - 630
MFQQQLAEKQLGLPPGMAMEGIRPSMEMNRMIPGSQRHMEPGNNPIFPRIPVEGPLSPSRGDFPKGIPPQ    631 - 700
MGPGRELEFGMVPSGMKGDVNLNVNMGSNSQMIPQKMREAGAGPEEMLKLRPGGSDMLPAQQKMVPLPFG    701 - 770
EHPQQEYGMGPRPFLPMSQGPGSNSGLRNLREPIGPDQRTNSRLSHMPPLPLNPSSNPTSLNTAPPVQRG    771 - 840
LGRKPLDISVAGSQVHSPGINPLKSPTMHQVQSPMLGSPSGNLKSPQTPSQLAGMLAGPAAAASIKSPPV    841 - 910
LGSAAASPVHLKSPSLPAPSPGWTSSPKPPLQSPGIPPNHKAPLTMASPAMLGNVESGGPPPPTASQPAS    911 - 980
VNIPGSLPSSTPYTMPPEPTLSQNPLSIMMSRMSKFAMPSSTPLYHDAIKTVASSDDDSPPARSPNLPSM    981 - 1050
NNMPGMGINTQNPRISGPNPVVPMPTLSPMGMTQPLSHSNQMPSPNAVGPNIPPHGVPMGPGLMSHNPIM   1051 - 1120
GHGSQEPPMVPQGRMGFPQGFPPVQSPPQQVPFPHNGPSGGQGSFPGGMGFPGEGPLGRPSNLPQSSADA   1121 - 1190
ALCKPGGPGGPDSFTVLGNSMPSVFTDPDLQEVIRPGATGIPEFDLSRIIPSEKPSQTLQYFPRGEVPGR   1191 - 1260
KQPQGPGPGFSHMQGMMGEQAPRMGLALPGMGGPGPVGTPDIPLGTAPSMPGHNPMRPPAFLQQGMMGPH   1261 - 1330
HRMMSPAQSTMPGQPTLMSNPAAAVGMIPGKDRGPAGLYTHPGPVGSPGMMMSMQGMMGPQQNIMIPPQM   1331 - 1400
RPRGMAADVGMGGFSQGPGNPGNMMF                                               1401 - 1426
//

Text Mined References (43)

PMID Year Title
26844272 2015 BCL9/9L-?-catenin Signaling is Associated With Poor Outcome in Colorectal Cancer.
26384318 2015 Expression profiling of in vivo ductal carcinoma in situ progression models identified B cell lymphoma-9 as a molecular driver of breast cancer invasion.
26081897 2015 PCDH10 inhibits cell proliferation of multiple myeloma via the negative regulation of the Wnt/?-catenin/BCL-9 signaling pathway.
24599134 2014 miR-30-5p functions as a tumor suppressor and novel therapeutic tool by targeting the oncogenic Wnt/?-catenin/BCL9 pathway.
24419084 2014 LEF1 and B9L shield ?-catenin from inactivation by Axin, desensitizing colorectal cancer cells to tankyrase inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23386608 2013 Dynamics of the rhomboid-like protein RHBDD2 expression in mouse retina and involvement of its human ortholog in retinitis pigmentosa.
23382809 2013 BCL9 and C9orf5 are associated with negative symptoms in schizophrenia: meta-analysis of two genome-wide association studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...