Property Summary

NCBI Gene PubMed Count 9
PubMed Score 164.11
PubTator Score 56.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.100 4.5e-02
Astrocytoma, Pilocytic 1.200 2.5e-03
atypical teratoid/rhabdoid tumor 1.400 4.6e-04
Breast cancer -1.100 3.5e-07
dermatomyositis 1.300 9.2e-03
ependymoma 1.100 7.3e-06
gastric carcinoma 1.100 3.5e-02
glioblastoma 1.100 7.4e-05
group 4 medulloblastoma 1.200 2.6e-02
juvenile dermatomyositis 1.181 1.6e-08
lung cancer 1.100 6.2e-03
Multiple myeloma 1.943 1.0e-04
osteosarcoma 1.445 1.8e-06
ovarian cancer -1.400 1.3e-05
primary pancreatic ductal adenocarcinoma 1.050 2.6e-02
Waldenstrons macroglobulinemia 1.253 4.1e-02

Gene RIF (1)

AA Sequence

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA      1 - 70
KNRDASTLQSQKAEGTGDAK                                                       71 - 90
//

Text Mined References (14)

PMID Year Title