Property Summary

NCBI Gene PubMed Count 8
PubMed Score 159.67
PubTator Score 56.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.253 0.041
Multiple myeloma 1.943 0.000
osteosarcoma 1.445 0.000
ependymoma 1.100 0.000
glioblastoma 1.100 0.000
sonic hedgehog group medulloblastoma 1.300 0.015
juvenile dermatomyositis 1.263 0.000
primary pancreatic ductal adenocarcinoma 1.050 0.026
lung cancer 1.100 0.006
pediatric high grade glioma 1.100 0.006
atypical teratoid/rhabdoid tumor 1.400 0.000
pilocytic astrocytoma 1.200 0.003
Breast cancer -1.100 0.000
gastric carcinoma 1.100 0.035
ovarian cancer -1.900 0.000
dermatomyositis 1.300 0.009

AA Sequence

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA      1 - 70
KNRDASTLQSQKAEGTGDAK                                                       71 - 90
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...