Property Summary

NCBI Gene PubMed Count 36
PubMed Score 183.22
PubTator Score 170.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 2.02216261085738E-24
lung carcinoma 2844 5.31851900297478E-13
malignant mesothelioma 3163 1.89258934123307E-9
posterior fossa group A ependymoma 1511 2.54101213576818E-9
osteosarcoma 7933 2.79514201699394E-6
Breast cancer 3099 4.36094488828617E-6
lung cancer 4473 4.55454196122149E-6
acute myeloid leukemia 785 5.12521292409492E-6
cystic fibrosis 1670 6.20984432703604E-6
ovarian cancer 8492 1.69432022683202E-5
pilocytic astrocytoma 3086 1.15677113189866E-4
pancreatic carcinoma 567 1.77352139443296E-4
interstitial cystitis 2299 2.95123185735282E-4
Pick disease 1893 7.93663223840009E-4
pediatric high grade glioma 2712 9.10975856824927E-4
lung adenocarcinoma 2714 0.0013284169081069
glioblastoma 5572 0.00681655950157418
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0074862587621603
astrocytoma 1493 0.00890601345412477
pancreatic cancer 2300 0.0121803639246742
atypical teratoid / rhabdoid tumor 4369 0.0131480886968785
ulcerative colitis 2087 0.0137257173700831
subependymal giant cell astrocytoma 2287 0.0146567808528115
invasive ductal carcinoma 2950 0.0167486470133474
group 4 medulloblastoma 1875 0.0236854851061091
primary pancreatic ductal adenocarcinoma 1271 0.0242294749419669
Crohn's disease 304 0.0257979748740548
esophageal adenocarcinoma 737 0.0320345812252767
medulloblastoma, large-cell 6234 0.0335856577812449
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 4.901 2.5
Disease Target Count Z-score Confidence
Gastroenteritis 46 4.512 2.3
Endometrial cancer 32 3.826 1.9
Disease Target Count
Bruck syndrome 8
Bruck syndrome 2 1

Expression

Synonym

Accession O00469 B3KWS3 Q59ED2 Q8N170
Symbols LH2
TLH
BRKS2

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (24)

PMID Text
26432637 findings reveal that TGFbeta1 induces a SP1- and SMAD3-dependent recruitment of histone modifying enzymes to the PLOD2 promoter other than the currently known TGFbeta1 downstream co-activators and epigenetic modifications
25664850 LH2 enhances the metastatic properties of tumor cells and functions as a regulatory switch that controls the relative abundance of biochemically distinct types of collagen cross-links in the tumor stroma.
24192939 TGFbeta induced PLOD2/LH2 expression in human synovial osteoarthritic fibroblasts through ALK5 signaling.
23906982 data indicate that HIF-1alpha controls sarcoma metastasis through PLOD2-dependent collagen modification and organization in primary tumors
23666869 Infrapatellar fat pad contributeS to the development of synovial fibrosis in the knee joint by increasing collagen production, PLOD2 expression, cell proliferation, and cell migration.
23423382 Hypoxia-inducible factor 1 (HIF-1) promotes extracellular matrix remodeling under hypoxic conditions by inducing P4HA1, P4HA2, and PLOD2 expression in fibroblasts.
22689593 PLOD2 in addition to causing BS is also associated with AR-OI phenotypes of variable severity
22190034 HIV-1 IN is identified to have a physical interaction with procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2 (PLOD2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22098155 PLOD2 is a potential novel prognostic factor for HCC patients following surgery.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGGCTVKPQLLLLALVLHPWNPCLGADSEKPSSIPTDKLLVITVATKESDGFHRFMQSAKYFNYTVKVLG      1 - 70
QGEEWRGGDGINSIGGGQKVRLMKEVMEHYADQDDLVVMFTECFDVIFAGGPEEVLKKFQKANHKVVFAA     71 - 140
DGILWPDKRLADKYPVVHIGKRYLNSGGFIGYAPYVNRIVQQWNLQDNDDDQLFYTKVYIDPLKREAINI    141 - 210
TLDHKCKIFQTLNGAVDEVVLKFENGKARAKNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQDNGCT    211 - 280
LCEFDTVDLSAVDVHPNVSIGVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKA    281 - 350
KHEIKTIKIVGPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTR    351 - 420
HGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGVWNVPYMANVYLIKGKTLRSEMNERNYFVRDKLDPD    421 - 490
MALCRNAREMGVFMYISNRHEFGRLLSTANYNTSHYNNDLWQIFENPVDWKEKYINRDYSKIFTENIVEQ    491 - 560
PCPDVFWFPIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQVDLENVWLHFIREFI    561 - 630
APVTLKVFAGYYTKGFALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQGGGCKFLRYNCSIE    631 - 700
SPRKGWSFMHPGRLTHLHEGLPVKNGTRYIAVSFIDP                                     701 - 737
//

Text Mined References (41)

PMID Year Title
26432637 2015 Procollagen Lysyl Hydroxylase 2 Expression Is Regulated by an Alternative Downstream Transforming Growth Factor ?-1 Activation Mechanism.
25664850 2015 Lysyl hydroxylase 2 induces a collagen cross-link switch in tumor stroma.
24192939 2014 TGF-ß induces Lysyl hydroxylase 2b in human synovial osteoarthritic fibroblasts through ALK5 signaling.
23906982 2013 Hypoxia-dependent modification of collagen networks promotes sarcoma metastasis.
23666869 2013 Stimulation of fibrotic processes by the infrapatellar fat pad in cultured synoviocytes from patients with osteoarthritis: a possible role for prostaglandin f2?.
23423382 2013 Hypoxia-inducible factor 1 (HIF-1) promotes extracellular matrix remodeling under hypoxic conditions by inducing P4HA1, P4HA2, and PLOD2 expression in fibroblasts.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22689593 2012 Mutations in PLOD2 cause autosomal-recessive connective tissue disorders within the Bruck syndrome--osteogenesis imperfecta phenotypic spectrum.
22098155 2012 PLOD2 induced under hypoxia is a novel prognostic factor for hepatocellular carcinoma after curative resection.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...