Property Summary

NCBI Gene PubMed Count 45
PubMed Score 220.43
PubTator Score 170.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Osteogenesis imperfecta 34 5.012 2.5
Disease Target Count Z-score Confidence
Gastroenteritis 41 4.464 2.2
Disease Target Count
Bruck syndrome 10

Expression

  Differential Expression (29)

Disease log2 FC p
acute myeloid leukemia -3.400 5.1e-06
adult high grade glioma 1.100 3.9e-02
astrocytoma 1.800 8.9e-03
Astrocytoma, Pilocytic 1.500 1.5e-04
atypical teratoid / rhabdoid tumor -1.500 1.3e-02
Breast cancer 1.800 4.4e-06
Crohn's disease -1.354 2.6e-02
cystic fibrosis 1.343 6.2e-06
ependymoma 1.400 8.2e-06
esophageal adenocarcinoma 1.200 3.2e-02
glioblastoma 1.300 6.0e-04
group 4 medulloblastoma -1.600 2.4e-02
interstitial cystitis 1.800 7.1e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.4e-02
invasive ductal carcinoma 1.087 9.1e-03
lung adenocarcinoma 1.300 3.1e-04
lung cancer 2.300 4.6e-06
lung carcinoma 1.400 5.3e-13
malignant mesothelioma -5.100 1.9e-09
medulloblastoma, large-cell -1.500 3.4e-02
non-small cell lung cancer 2.497 2.0e-24
osteosarcoma 5.083 2.8e-06
ovarian cancer -1.400 7.2e-03
pancreatic cancer 1.100 1.8e-04
pancreatic carcinoma 1.100 1.8e-04
Pick disease 1.600 7.9e-04
primary pancreatic ductal adenocarcinoma 1.867 2.4e-02
subependymal giant cell astrocytoma 2.538 4.4e-02
ulcerative colitis -1.651 1.4e-02

Gene RIF (31)

AA Sequence

MGGCTVKPQLLLLALVLHPWNPCLGADSEKPSSIPTDKLLVITVATKESDGFHRFMQSAKYFNYTVKVLG      1 - 70
QGEEWRGGDGINSIGGGQKVRLMKEVMEHYADQDDLVVMFTECFDVIFAGGPEEVLKKFQKANHKVVFAA     71 - 140
DGILWPDKRLADKYPVVHIGKRYLNSGGFIGYAPYVNRIVQQWNLQDNDDDQLFYTKVYIDPLKREAINI    141 - 210
TLDHKCKIFQTLNGAVDEVVLKFENGKARAKNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQDNGCT    211 - 280
LCEFDTVDLSAVDVHPNVSIGVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKA    281 - 350
KHEIKTIKIVGPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTR    351 - 420
HGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGVWNVPYMANVYLIKGKTLRSEMNERNYFVRDKLDPD    421 - 490
MALCRNAREMGVFMYISNRHEFGRLLSTANYNTSHYNNDLWQIFENPVDWKEKYINRDYSKIFTENIVEQ    491 - 560
PCPDVFWFPIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQVDLENVWLHFIREFI    561 - 630
APVTLKVFAGYYTKGFALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQGGGCKFLRYNCSIE    631 - 700
SPRKGWSFMHPGRLTHLHEGLPVKNGTRYIAVSFIDP                                     701 - 737
//

Text Mined References (50)

PMID Year Title