Property Summary

NCBI Gene PubMed Count 156
Grant Count 79
R01 Count 47
Funding $5,600,403.42
PubMed Score 396.60
PubTator Score 237.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
hereditary spastic paraplegia -1.034 0.011
lung cancer 1.200 0.001

Synonym

Accession O00429 A8K4X9 B4DGC9 B4DSU8 J3KPI2 O14541 O60709 Q59GN9 Q7L6B3 Q8TBT7 Q9BWM1 Q9Y5J2
Symbols DLP1
DRP1
DVLP
EMPF
EMPF1
DYMPLE
HDYNIV

Gene

PDB

3W6N   3W6O   3W6P   4BEJ   4H1U   4H1V  

Gene RIF (118)

PMID Text
26915633 Haploinsufficiency of Drp1 abolished mitochondrial autophagy and exacerbated the development of heart failure.
26903540 The results indicate that Drp1-dependent mitochondrial fission through MiD49/MiD51 regulates cristae remodeling during intrinsic apoptosis.
26825290 DNM1L has a critical role in regulating mitochondrial morphology and function [case report of two siblings]
26812016 that KIF1Bbeta affects mitochondrial dynamics through calcineurin-dependent dephosphorylation of Dynamin-related protein 1 (DRP1), causing mitochondrial fission and apoptosis
26609810 Drp1 is in dynamic equilibrium on mitochondria in a fission-independent manner, and that fission factors such as actin filaments target productive oligomerization to fission sites.
26598294 Dynamin-related protein 1 (Dpr1) activates mitochondrial-dependent apoptosis and indicate that inhibiting Dpr1 function can protect against chlorpyrifos-induced cytotoxicity.
26578513 membrane-anchored Mff differentially regulates various Drp1 isoforms.
26577411 These findings provide new insights into the role of the Drp1-dependent mitochondrial pathway in the pathology of osteoporosis.
26518267 In neuroblastoma cells, hnRNP A1 directly interacts with Drp1 mRNA at its 3'UTR region, and enhances translation potential without affecting mRNA stability.
26384664 Activation of apoptosis triggers MAPL/MUL1-dependent SUMOylation of the fission GTPase Drp1, a process requisite for cytochrome c release.
More...

AA Sequence

MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHV      1 - 70
SQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVV     71 - 140
NLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRT    141 - 210
LAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRN    211 - 280
GTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG    281 - 350
TAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ    351 - 420
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIE    421 - 490
LAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLI    491 - 560
QDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPV    561 - 630
PVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLL    631 - 700
TESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW                                      701 - 736
//

Text Mined References (176)

PMID Year Title
27145208 2016 A novel de novo dominant negative mutation in DNM1L impairs mitochondrial fission and presents as childhood epileptic encephalopathy.
27059175 2016 SAMM50 Affects Mitochondrial Morphology through the Association of Drp1 in Mammalian Cells.
26992161 2016 Postnatal microcephaly and pain insensitivity due to a de novo heterozygous DNM1L mutation causing impaired mitochondrial fission and function.
26915633 2016 Drp1-Dependent Mitochondrial Autophagy Plays a Protective Role Against Pressure Overload-Induced Mitochondrial Dysfunction and Heart Failure.
26903540 2016 Drp1-dependent mitochondrial fission via MiD49/51 is essential for apoptotic cristae remodeling.
26825290 2016 Lethal Disorder of Mitochondrial Fission Caused by Mutations in DNM1L.
26812016 2016 The 1p36 Tumor Suppressor KIF 1B? Is Required for Calcineurin Activation, Controlling Mitochondrial Fission and Apoptosis.
26618722 2016 Parkinson's disease-associated mutant VPS35 causes mitochondrial dysfunction by recycling DLP1 complexes.
26609810 2015 Actin filaments target the oligomeric maturation of the dynamin GTPase Drp1 to mitochondrial fission sites.
26604000 2016 DNM1L-related mitochondrial fission defect presenting as refractory epilepsy.
More...