Property Summary

Ligand Count 144
NCBI Gene PubMed Count 14
PubMed Score 16.14
PubTator Score 12.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0
Disease Target Count Z-score Confidence
Paraplegia 74 4.661 2.3
Aceruloplasminemia 16 3.219 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.249 7.0e-03
adrenocortical carcinoma -1.215 6.2e-08
glioblastoma 1.300 7.9e-03
non-small cell lung cancer 1.062 2.0e-13
osteosarcoma 1.202 6.2e-03
ovarian cancer -1.200 2.1e-03
pancreatic cancer -1.200 5.4e-03
pancreatic ductal adenocarcinoma liver m... -1.749 3.2e-03
pituitary cancer -1.500 7.7e-08

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRA      1 - 70
ELSSILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFSLKLLWAPLVDAVYVKNFGRR     71 - 140
KSWLVPTQYILGLFMIYLSTQVDRLLGNTDDRTPDVIALTVAFFLFEFLAATQDIAVDGWALTMLSRENV    141 - 210
GYASTCNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKK    211 - 280
ENEVSVVKEETQGITDTYKLLFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVEEGVPKEHLALLAV    281 - 350
PMVPLQIILPLIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPIYYYIVVLLSYAL    351 - 420
HQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQNCRTP    421 - 490
DAVELCKKLGGSCVTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGSSSWKCKRNN               491 - 549
//

Text Mined References (17)

PMID Year Title