Property Summary

NCBI Gene PubMed Count 612
PubMed Score 1623.99
PubTator Score 1674.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Paget's disease of bone 36 4.1 2.0

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.092 9.8e-03
adult high grade glioma 1.300 3.0e-03
Astrocytoma, Pilocytic 1.700 5.8e-06
atypical teratoid / rhabdoid tumor 1.300 4.8e-02
ependymoma 4.700 4.7e-15
glioblastoma 1.300 4.4e-02
interstitial cystitis 3.300 7.2e-03
lung cancer 2.300 2.2e-05
lung carcinoma 2.700 4.1e-23
malignant mesothelioma -2.700 2.9e-06
non diabetic and post-ischemic heart fai... -1.900 2.8e-02
osteosarcoma 1.813 2.6e-02
ovarian cancer -1.300 4.6e-04
pancreatic cancer 1.500 3.3e-03
pituitary cancer 1.100 3.1e-02
ulcerative colitis 2.700 2.0e-04

 CSPA Cell Line (1)

Gene RIF (617)

AA Sequence

MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYY      1 - 70
TDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNT     71 - 140
VCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFA    141 - 210
VPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENS    211 - 280
VQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALK    281 - 350
HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL                       351 - 401
//

Text Mined References (614)

PMID Year Title