Property Summary

NCBI Gene PubMed Count 561
Grant Count 226
R01 Count 130
Funding $22,438,530.66
PubMed Score 1531.29
PubTator Score 1674.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
osteosarcoma 1.961 0.025
posterior fossa group A ependymoma 5.500 0.000
glioblastoma 1.300 0.044
non diabetic and post-ischemic heart fai... -1.900 0.028
atypical teratoid/rhabdoid tumor 1.500 0.005
lung cancer 2.300 0.000
active Crohn's disease 1.092 0.010
pancreatic cancer 1.500 0.003
interstitial cystitis 3.400 0.005
pediatric high grade glioma 1.300 0.002
pilocytic astrocytoma 1.700 0.000
lung carcinoma 2.700 0.000
ulcerative colitis 2.700 0.000
ovarian cancer -1.300 0.000
pituitary cancer 1.100 0.031

Synonym

Accession O00300 B2R9A8 O60236 Q53FX6 Q9UHP4
Symbols OPG
TR1
OCIF
PDB5

Gene

PDB

3URF  

Gene RIF (566)

PMID Text
26913505 Osteoprotegerin together with inflammation and immunosenescence in HIV positive patients could affect bone and vascular system
26798969 The SNP rs2073618 in OPG is associated with an increased risk of musculoskeletal and pain with aromatase inhibitor therapy.
26722486 Hypoxia can affect the expression of RANKL and OPG in human periodontal ligament cells
26671549 In lung cancer, serum OPG levels in the BM and BM- groups were significantly increased compared with healthy controls.
26669972 Germline variation in TNFRSF11B gene is associated with the risk of multiple myeloma bone disease.
26664786 Single nucleotide polymorphisms (SNPs) rs1035798 in RAGE gene, rs2073617 and rs2073618 in TNFRSF11B, and rs3732410 in Golgb1 will be investigated on whether there is an association with hemorrhagic stroke (HS) in Chinese population.
26652270 Suggest that bone like arterial calcification is highly prevalent at femoral level. Pericyte cells and the OPG/RANK/RANKL triad seem to be critical to this process.
26635910 the independent and positive (beta = 0.449, p = 0.004, and R(2) = 0.185) association between the OxS marker and RANKL/OPG ratio which was found in osteopenic but not in the other 2 sample groups.
26629528 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-kappaB Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers
26617755 expression of OPG, RANK and RANKL genes exert a crucial role in the progression of avascular necrosis
More...

AA Sequence

MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYY      1 - 70
TDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNT     71 - 140
VCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFA    141 - 210
VPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENS    211 - 280
VQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALK    281 - 350
HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL                       351 - 401
//

Text Mined References (563)

PMID Year Title
26913505 2016 Higher Levels of Osteoprotegerin and Immune Activation/Immunosenescence Markers Are Correlated with Concomitant Bone and Endovascular Damage in HIV-Suppressed Patients.
26798969 2016 Genetic variant in the osteoprotegerin gene is associated with aromatase inhibitor-related musculoskeletal toxicity in breast cancer patients.
26722486 2015 Effect of hypoxia on the expression of RANKL/OPG in human periodontal ligament cells in vitro.
26671549 2015 The effects of lung and prostate cancer bone metastasis on serum osteoprotegerin levels: a meta-analysis.
26669972 2016 Genetic factors influencing the risk of multiple myeloma bone disease.
26664786 2015 Polymorphisms in three genes are associated with hemorrhagic stroke.
26652270 2016 Bone Like Arterial Calcification in Femoral Atherosclerotic Lesions: Prevalence and Role of Osteoprotegerin and Pericytes.
26635910 2016 Higher Urinary Levels of 8-Hydroxy-2'-deoxyguanosine Are Associated with a Worse RANKL/OPG Ratio in Postmenopausal Women with Osteopenia.
26629528 2015 Osteoprotegerin (OPG), The Endogenous Inhibitor of Receptor Activator of NF-?B Ligand (RANKL), is Dysregulated in BRCA Mutation Carriers.
26617755 2015 Expression of osteoprotegerin, RNAK and RANKL genes in femoral head avascular necrosis and related signaling pathway.
More...