Property Summary

NCBI Gene PubMed Count 11
PubMed Score 97.49
PubTator Score 31.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -1.249 4.4e-02
cystic fibrosis and chronic rhinosinusit... -1.081 4.2e-02
osteosarcoma 1.279 1.8e-03
ovarian cancer -1.900 9.6e-05
pancreatic cancer 1.600 1.0e-03
pancreatic carcinoma 1.600 1.0e-03

Gene RIF (4)

AA Sequence

MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFA      1 - 70
RYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLIWKYYSVPVAVVPSKWITPLD     71 - 140
RLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS                                        141 - 174
//

Text Mined References (12)

PMID Year Title