Property Summary

NCBI Gene PubMed Count 49
Grant Count 4
Funding $187,437.6
PubMed Score 11.30
PubTator Score 8.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.011 0.004
malignant mesothelioma 1.800 0.000
ependymoma -1.100 0.030
osteosarcoma -1.475 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
tuberculosis and treatment for 6 months 1.700 0.000
lung cancer 1.300 0.001
pediatric high grade glioma -1.100 0.000
subependymal giant cell astrocytoma -1.128 0.008
lung adenocarcinoma 1.022 0.000
Pick disease -1.200 0.004
Breast cancer -1.400 0.000
ovarian cancer 1.700 0.000

Synonym

Accession O00231 A8K3I7 E1P663 O00495 Q53FT5
Symbols S9
Rpn6
p44.5

Gene

PDB

5GJQ   5GJR   5L4K  

Gene RIF (32)

PMID Text
26669444 Data show that activated PKA phosphorylates the 19S subunit, Rpn6/PSMD11 (regulatory particle non-ATPase 6/proteasome subunit D11) at Ser14.
22972301 human embryonic stem cells (hESCs) exhibit high proteasome activity that is correlated with increased levels of the 19S proteasome subunit PSMD11 (known as RPN-6 in Caenorhabditis elegans) and a corresponding increased assembly of the 26S/30S proteasome
22190034 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19616115 AMP-activated protein kinase is able to interact physically with this subunit and modify its phosphorylation status.
14614829 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14564014 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14557625 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14550573 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14550573 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14528301 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 11 (PSMD11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLL      1 - 70
KYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDT     71 - 140
KRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATL    141 - 210
DMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYA    211 - 280
GRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI    281 - 350
SSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK    351 - 420
LT                                                                        421 - 422
//

Text Mined References (57)

PMID Year Title
26669444 2015 cAMP-induced phosphorylation of 26S proteasomes on Rpn6/PSMD11 enhances their activity and the degradation of misfolded proteins.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22972301 2012 Increased proteasome activity in human embryonic stem cells is regulated by PSMD11.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...