Property Summary

NCBI Gene PubMed Count 44
Grant Count 5
R01 Count 5
Funding $243,060.73
PubMed Score 20.54
PubTator Score 10.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

 GWAS Trait (1)

Gene RIF (29)

PMID Text
26870821 A NFKBIE polymorphism was associated with increased risk of pneumococcal meningitis.
26343386 Newly identified alterations included recurrent promoter mutations of NFKBIE, encoding NF-kappaB inhibitor varepsilon (IkappaBvarepsilon), in 14.5% of samples of desmoplastic melanoma
26226212 results show that Gal-1 acts by inhibiting the stimulation of the LPS-induced IkappaBzeta expression, an NF-kappaB regulator involved in IL-6 gene transcription.
25987724 IkappaBepsilon has a role in NF-kappaB regulation in aggressive chronic lymphocytic leukemia
23615073 Vitamin C forestalls cigarette smoke induced NF-kappaB activation in alveolar epithelial cells.
23028356 we identified two gene loci associated with rheumatoid arthritis susceptibility- NFKBIE and RTKN2
20711808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MNQRRSESRPGNHRLQAYAEPGKGDSGGAGPLSGSARRGRGGGGAIRVRRPCWSGGAGRGGGPAWAVRLP      1 - 70
TVTAGWTWPALRTLSSLRAGPSEPHSPGRRPPRAGRPLCQADPQPGKAARRSLEPDPAQTGPRPARAAGM     71 - 140
SEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPSDGSPQPCTHPPGPVKEPQEKEDADGERADS    141 - 210
TYGSSSLTYTLSLLGGPEAEDPAPRLPLPHVGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLA    211 - 280
LLPQEVLDIQNNLYQTALHLAVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACARCLLEGR    281 - 350
PEPGRGTSHSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLV    351 - 420
QFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLK    421 - 490
ISGKLLLCTD                                                                491 - 500
//

Text Mined References (46)

PMID Year Title
26870821 2016 Genetic Variation in NFKBIE Is Associated With Increased Risk of Pneumococcal Meningitis in Children.
26343386 2015 Exome sequencing of desmoplastic melanoma identifies recurrent NFKBIE promoter mutations and diverse activating mutations in the MAPK pathway.
26226212 2015 Galectin-1 reduced the effect of LPS on the IL-6 production in decidual cells by inhibiting LPS on the stimulation of I?B?.
25987724 2015 Functional loss of I?B? leads to NF-?B deregulation in aggressive chronic lymphocytic leukemia.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23615073 2013 Vitamin C forestalls cigarette smoke induced NF-?B activation in alveolar epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028356 2012 Functional variants in NFKBIE and RTKN2 involved in activation of the NF-?B pathway are associated with rheumatoid arthritis in Japanese.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...