Property Summary

NCBI Gene PubMed Count 48
PubMed Score 82.64
PubTator Score 67.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.700 4.9e-03
atypical teratoid / rhabdoid tumor 1.200 1.2e-03
breast carcinoma -1.100 5.7e-04
ductal carcinoma in situ -1.100 4.5e-03
ependymoma 1.800 5.6e-03
invasive ductal carcinoma -1.400 7.0e-03
lung carcinoma -1.500 4.1e-17
mucosa-associated lymphoid tissue lympho... 1.142 8.8e-03
non-small cell lung cancer -1.001 1.8e-12
oligodendroglioma 1.800 2.7e-03
osteosarcoma 1.856 3.8e-06
ovarian cancer -1.200 1.2e-04
pancreatic ductal adenocarcinoma liver m... 1.202 2.2e-02

Gene RIF (24)

AA Sequence

MALQVELVPTGEIIRVVHPHRPCKLALGSDGVRVTMESALTARDRVGVQDFVLLENFTSEAAFIENLRRR      1 - 70
FRENLIYTYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHLFAVADTVYRALRTERRDQAVMISG     71 - 140
ESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKG    141 - 210
APVGGHILSYLLEKSRVVHQNHGERNFHIFYQLLEGGEEETLRRLGLERNPQSYLYLVKGQCAKVSSIND    211 - 280
KSDWKVVRKALTVIDFTEDEVEDLLSIVASVLHLGNIHFAANEESNAQVTTENQLKYLTRLLSVEGSTLR    281 - 350
EALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVYSRTFTWLVGKINRSLASKDVESPSWRSTTVLGLL    351 - 420
DIYGFEVFQHNSFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIAWEPVQYFNNKIICDLVEEKFKGI    421 - 490
ISILDEECLRPGEATDLTFLEKLEDTVKHHPHFLTHKLADQRTRKSLGRGEFRLLHYAGEVTYSVTGFLD    491 - 560
KNNDLLFRNLKETMCSSKNPIMSQCFDRSELSDKKRPETVATQFKMSLLQLVEILQSKEPAYVRCIKPND    561 - 630
AKQPGRFDEVLIRHQVKYLGLLENLRVRRAGFAYRRKYEAFLQRYKSLCPETWPTWAGRPQDGVAVLVRH    631 - 700
LGYKPEEYKMGRTKIFIRFPKTLFATEDALEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRG    701 - 770
TLGRRKAAKRKWAAQTIRRLIRGFVLRHAPRCPENAFFLDHVRTSFLLNLRRQLPQNVLDTSWPTPPPAL    771 - 840
REASELLRELCIKNMVWKYCRSISPEWKQQLQQKAVASEIFKGKKDNYPQSVPRLFISTRLGTDEISPRV    841 - 910
LQALGSEPIQYAVPVVKYDRKGYKPRSRQLLLTPNAVVIVEDAKVKQRIDYANLTGISVSSLSDSLFVLH    911 - 980
VQRADNKQKGDVVLQSDHVIETLTKTALSANRVNSININQGSITFAGGPGRDGTIDFTPGSELLITKAKN    981 - 1050
GHLAVVAPRLNSR                                                            1051 - 1063
//

Text Mined References (59)

PMID Year Title