Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.39
PubTator Score 2.32

Knowledge Summary

Patent (1,150)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.600 0.000

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human G protein-coupled receptor 25 (GPR25) at amino acid residues 315-316 by the HIV-1 protease
17386346 GPR-25 is homologous to receptors involved in blood pressure regulation.

AA Sequence

MAPTEPWSPSPGSAPWDYSGLDGLEELELCPAGDLPYGYVYIPALYLAAFAVGLLGNAFVVWLLAGRRGP      1 - 70
RRLVDTFVLHLAAADLGFVLTLPLWAAAAALGGRWPFGDGLCKLSSFALAGTRCAGALLLAGMSVDRYLA     71 - 140
VVKLLEARPLRTPRCALASCCGVWAVALLAGLPSLVYRGLQPLPGGQDSQCGEEPSHAFQGLSLLLLLLT    141 - 210
FVLPLVVTLFCYCRISRRLRRPPHVGRARRNSLRIIFAIESTFVGSWLPFSALRAVFHLARLGALPLPCP    211 - 280
LLLALRWGLTIATCLAFVNSCANPLIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCR    281 - 350
AQAANTASASW                                                               351 - 361
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17386346 2007 A whole genome scan for pulse pressure/stroke volume ratio in African Americans: the HyperGEN study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9020062 1997 Discovery of a novel human G protein-coupled receptor gene (GPR25) located on chromosome 1.