Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.39
PubTator Score 2.32

Knowledge Summary

Patent (1,150)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.57687567984564E-7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.600 0.000

Synonym

Accession O00155 A0AVJ5
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (2)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human G protein-coupled receptor 25 (GPR25) at amino acid residues 315-316 by the HIV-1 protease
17386346 GPR-25 is homologous to receptors involved in blood pressure regulation.

AA Sequence

MAPTEPWSPSPGSAPWDYSGLDGLEELELCPAGDLPYGYVYIPALYLAAFAVGLLGNAFVVWLLAGRRGP      1 - 70
RRLVDTFVLHLAAADLGFVLTLPLWAAAAALGGRWPFGDGLCKLSSFALAGTRCAGALLLAGMSVDRYLA     71 - 140
VVKLLEARPLRTPRCALASCCGVWAVALLAGLPSLVYRGLQPLPGGQDSQCGEEPSHAFQGLSLLLLLLT    141 - 210
FVLPLVVTLFCYCRISRRLRRPPHVGRARRNSLRIIFAIESTFVGSWLPFSALRAVFHLARLGALPLPCP    211 - 280
LLLALRWGLTIATCLAFVNSCANPLIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCR    281 - 350
AQAANTASASW                                                               351 - 361
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17386346 2007 A whole genome scan for pulse pressure/stroke volume ratio in African Americans: the HyperGEN study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9020062 1997 Discovery of a novel human G protein-coupled receptor gene (GPR25) located on chromosome 1.