Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.39
PubTator Score 2.32

Knowledge Summary

Patent (1,150)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.600 5.6e-07

Gene RIF (2)

AA Sequence

MAPTEPWSPSPGSAPWDYSGLDGLEELELCPAGDLPYGYVYIPALYLAAFAVGLLGNAFVVWLLAGRRGP      1 - 70
RRLVDTFVLHLAAADLGFVLTLPLWAAAAALGGRWPFGDGLCKLSSFALAGTRCAGALLLAGMSVDRYLA     71 - 140
VVKLLEARPLRTPRCALASCCGVWAVALLAGLPSLVYRGLQPLPGGQDSQCGEEPSHAFQGLSLLLLLLT    141 - 210
FVLPLVVTLFCYCRISRRLRRPPHVGRARRNSLRIIFAIESTFVGSWLPFSALRAVFHLARLGALPLPCP    211 - 280
LLLALRWGLTIATCLAFVNSCANPLIYLLLDRSFRARALDGACGRTGRLARRISSASSLSRDDSSVFRCR    281 - 350
AQAANTASASW                                                               351 - 361
//

Text Mined References (5)

PMID Year Title