Property Summary

NCBI Gene PubMed Count 23
PubMed Score 61.79
PubTator Score 26.78

Knowledge Summary

Patent (2,489)

TINX Plot

  Disease (3)

Disease Target Count P-value
group 3 medulloblastoma 4104 3.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 3.824 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.2e-03

Gene RIF (12)

AA Sequence

MAVAPLRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAA      1 - 70
AELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCA     71 - 140
RLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKFQYVEKSRS    141 - 210
CAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLA    211 - 280
FLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEA    281 - 350
IEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTG    351 - 420
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCAAAAG    421 - 490
PGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGS    491 - 560
YGRGTHCHYKAPTVVLHMTKTDPSLENPTHL                                           561 - 591
//

Text Mined References (23)

PMID Year Title