Property Summary

NCBI Gene PubMed Count 21
PubMed Score 59.75
PubTator Score 26.78

Knowledge Summary

Patent (2,489)


  Disease Sources (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 0.00321677768947664
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.842 1.9


  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma -1.100 0.003


Accession O00144 Fz-9
Symbols FZD3


  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (10)

20501643 The activity of the Sprouty4 promoter is increased by Wnt7A/Fzd9 signaling through peroxisome proliferator-activated receptor gamma in lung cancer cells.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20458727 The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and that the frizzled-9/Wnt pathway is important in proliferation and differentiation.
20398908 Observational study of gene-disease association. (HuGE Navigator)
19724923 SiRNA of frizzled-9 suppresses proliferation and motility of hepatoma cells.
19543507 Observational study of gene-disease association. (HuGE Navigator)
19038973 The results suggest that WNT2 could act through its receptor FZD9 to regulate the beta-CATENIN pathway in cumulus cells, recruiting beta-CATENIN into plasma membranes and promoting the formation of adherens junctions involving CDH1.
18832655 Aberrant DNA methylation of frizzled 9 protein is associated with myelodysplastic syndrome progression to acute myeloid leukemia.
16835228 ERK5-dependent activation of PPARgamma represents a major effector pathway mediating the anti-tumorigenic effects of Wnt 7a and Fzd 9 in non-small cell lung cancer cells
15705594 transfection of Fzd-9 into a Wnt-7a-insensitive NSCLC cell line established Wnt-7a sensitivity

AA Sequence

YGRGTHCHYKAPTVVLHMTKTDPSLENPTHL                                           561 - 591

Text Mined References (21)

PMID Year Title
27509850 2016 A human neurodevelopmental model for Williams syndrome.
20501643 2010 Sprouty-4 inhibits transformed cell growth, migration and invasion, and epithelial-mesenchymal transition, and is regulated by Wnt7A through PPARgamma in non-small cell lung cancer.
20458727 2010 Expression profile of the embryonic markers nanog, OCT-4, SSEA-1, SSEA-4, and frizzled-9 receptor in human periodontal ligament mesenchymal stem cells.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
19724923 2009 SiRNA of frizzled-9 suppresses proliferation and motility of hepatoma cells.
19543507 2009 Non-association between polymorphisms of the frizzled receptor genes and bone mineral density in postmenopausal Korean women.
19038973 2009 Identification of WNT/beta-CATENIN signaling pathway components in human cumulus cells.
18832655 2009 Aberrant DNA methylation is a dominant mechanism in MDS progression to AML.
16835228 2006 Antitumorigenic effect of Wnt 7a and Fzd 9 in non-small cell lung cancer cells is mediated through ERK-5-dependent activation of peroxisome proliferator-activated receptor gamma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.