Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 4.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 6.8e-07
ovarian cancer 8520 1.5e-06

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.200 6.8e-07
ovarian cancer -1.200 1.5e-06

AA Sequence

MASRGVVGIFFLSAVPLVCLELRRGIPDIGIKDFLLLCGRILLLLALLTLIISVTTSWLNSFKSPQVYLK      1 - 70
EEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHKLGGDEGT     71 - 140
SQTSFETSNREAAKSQNLPKPLTEFPSPAEQPTCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLK    141 - 210
SYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQTN              211 - 270
//

Text Mined References (7)

PMID Year Title