Property Summary

NCBI Gene PubMed Count 73
PubMed Score 128.79
PubTator Score 222.89

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.200 2.7e-02

Gene RIF (36)

PMID Text
25628361 Complementary structural, biochemical and cellular techniques indicated that the formation of a symmetric RNA binding platform generated by dimerization of NXF1:NXT1 facilitates the recognition of CTE-RNA and promotes its nuclear export
25360769 Hepatitis B virus core protein associates with the cellular NXF1-p15 complex via the nuclear export signal motif of hepatitis B virus core protein.Nuclear export of human hepatitis B virus core protein and pregenomic RNA depends on the NXF1-p15 machinery.
25212909 Gag polyprotein synthesis was decreased by NXF1 knockdown.
24753416 HIV-1 Rev specifically inhibits the association of TAP with spliced RRE-containing RNA and the TAP-dependent pathway reduces singly spliced and unspliced HIV-1 RNA levels
24478440 HIV-1 Rev specifically inhibits the association of TAP with spliced RRE-containing RNA and the TAP-dependent pathway reduces singly spliced and unspliced HIV-1 RNA levels
23826332 a spatial map is produced in living cells of the sites for the interaction of two TREX subunits, Alyref and Chtop, with Nxf1.
22893130 TREX is the major complex used to recruit Nxf1 to mRNA in human cells.
21965294 the organization of the NXF1 proline-tyrosine nuclear localization signal reveal unexpected redundancy in the nuclear import pathways used by NXF1.
21822283 The crystal structure of the RNA recognition and leucine-rich repeat motifs of TAP bound to one symmetrical half of the CTE RNA is solved.
21725067 The U2AF65 protein served as an adaptor to link expanded CAG RNA to NXF1 for RNA export.
21613532 Tpr plays an important role in quality control of mRNA trafficked on the Nxf1 pathway.
21299467 these data revealed a redox-regulated chaperone function of PDI in delivering antigenic peptides from TAP to MHC-I.
21060739 These results showed that the interaction between herpes simplex virus type 1 ICP27 and human TAP/NXF1 occurred in living cells upon head-to-tail intramolecular association of ICP27.
20071484 Depletion of NXF1 or 5,6-dichloro-1-beta-d-ribofuranosyl-benzimidazole treatment had similar effects, inhibiting the nuclear export of several of the H5N1 influenza virus mRNAs.
20015986 Results describe the subcellular localization of ICP27 and its colocalization with cellular RNA export factors Aly/REF and TAP/NXF1.
19924249 Varicella-zoster virus IE4 protein interacts with SR proteins and exports mRNAs through the TAP/NXF1 pathway
19586903 The RNA-binding motif protein 15B (RBM15B/OTT3) acts as cofactor of the nuclear export receptor NXF1.
19586903 HIV-1 Rev specifically inhibits the association of TAP with spliced RRE-containing RNA and the TAP-dependent pathway reduces singly spliced and unspliced HIV-1 RNA levels
19369354 TAP/NXF1, but not Aly/REF, is required for RNA export during HSV-1 infection.
19019956 ICP27 is the major export adaptor for HSV-1 mRNA and that it links bound transcripts to the TAP/NXF1 export receptor
18854154 Knockdown of nuclear RNA export factor 1 (NXF1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18670889 The efficiency and stability of the approach are demonstrated by reconstructing the structure of a two domain region of the 31 kDa nuclear export factor TAP (TIP-associated protein).
17978099 Homotypic Tap complex can interact with both Nxt1 and nucleoporins in vitro.
17978099 oligomerization of Tap affects its interactions with nucleoporins
17609285 ORF57 interacts with the cellular export factor REF and with RNA, suggesting that it may provide target mRNAs with access to REF, which mediates nuclear RNA export by binding to TAP/NXF1.
17333237 evidence presented that the export factor TAP/NXF1 binds poorly to XIST RNA in comparison to exported mRNAs, suggesting that reduced TAP/NFX1 binding may contribute to nuclear retention of XIST RNA
17001072 RNA transport element RTE evolved as a high affinity RBM15 ligand to provide a splicing-independent link to NXF1, thereby ensuring efficient nuclear export and expression of retrotransposon transcripts
16971948 results indicate that Tap regulates expression of its own intron-containing RNA through a CTE (constitutive transport element)-mediated mechanism
15767397 concluded that herpes simplex virus type 1 ICP27 and the viral RNAs to which it binds are exported via the TAP/NXF1 export receptor.
15210956 SR proteins 9G8 and ASF/SF2 exhibit higher affinity for TAP/NXF1 when hypophosphorylated
15184380 hypophosphorylation of ASF in mRNPs coincides with its higher affinity for TAP
14963046 nuclear export sequences regulate human TAP function in mRNA export by direct nuclear pore interactions
12581645 structural basis for interaction of UBA domain and FG nucleoporins
12384575 Karyopherin beta2B is a nuclear export factor and mediates mRNA export in cooperation with TAP
11875519 Structure of the C-terminal FG-nucleoporin binding domain of Tap/NXF1
11854490 The structural and mutational data define a novel RNA-binding site on the Tap protein

AA Sequence

MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRV      1 - 70
RYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQ     71 - 140
SKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVE    141 - 210
QLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRL    211 - 280
DDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLR    281 - 350
LDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI    351 - 420
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTL    421 - 490
LCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPV    491 - 560
PTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK               561 - 619
//

Text Mined References (82)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25628361 2015 The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
25416956 2014 A proteome-scale map of the human interactome network.
25360769 2014 Nuclear export of human hepatitis B virus core protein and pregenomic RNA depends on the cellular NXF1-p15 machinery.
25212909 2014 Gammaretroviral pol sequences act in cis to direct polysome loading and NXF1/NXT-dependent protein production by gag-encoded RNA.
23826332 2013 Mapping interactions between mRNA export factors in living cells.
23477864 2013 The lipid mediator protectin D1 inhibits influenza virus replication and improves severe influenza.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22893130 2012 TREX exposes the RNA-binding domain of Nxf1 to enable mRNA export.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22334672 2012 Herpes simplex virus ICP27 protein directly interacts with the nuclear pore complex through Nup62, inhibiting host nucleocytoplasmic transport pathways.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21965294 2011 Evolutionary development of redundant nuclear localization signals in the mRNA export factor NXF1.
21822283 2011 Structure-function studies of nucleocytoplasmic transport of retroviral genomic RNA by mRNA export factor TAP.
21725067 2011 Perturbation of U2AF65/NXF1-mediated RNA nuclear export enhances RNA toxicity in polyQ diseases.
21699900 2011 Facioscapulohumeral muscular dystrophy region gene 1 is a dynamic RNA-associated and actin-bundling protein.
21613532 2011 The Tpr protein regulates export of mRNAs with retained introns that traffic through the Nxf1 pathway.
21299467 2011 Redox-regulated peptide transfer from the transporter associated with antigen processing to major histocompatibility complex class I molecules by protein disulfide isomerase.
21269460 2011 Initial characterization of the human central proteome.
21060739 2010 Head-to-tail intramolecular interaction of herpes simplex virus type 1 regulatory protein ICP27 is important for its interaction with cellular mRNA export receptor TAP/NXF1.
20123736 2010 TRAP150 activates pre-mRNA splicing and promotes nuclear mRNA degradation.
20071484 2010 Individual influenza A virus mRNAs show differential dependence on cellular NXF1/TAP for their nuclear export.
20015986 2010 ICP27 phosphorylation site mutants display altered functional interactions with cellular export factors Aly/REF and TAP/NXF1 but are able to bind herpes simplex virus 1 RNA.
19924249 2009 Varicella-zoster virus IE4 protein interacts with SR proteins and exports mRNAs through the TAP/NXF1 pathway.
19836239 2009 UIF, a New mRNA export adaptor that works together with REF/ALY, requires FACT for recruitment to mRNA.
19586903 2009 The RNA-binding motif protein 15B (RBM15B/OTT3) acts as cofactor of the nuclear export receptor NXF1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369354 2009 The cellular RNA export receptor TAP/NXF1 is required for ICP27-mediated export of herpes simplex virus 1 RNA, but the TREX complex adaptor protein Aly/REF appears to be dispensable.
19324961 2009 Assembly and mobility of exon-exon junction complexes in living cells.
19165146 2009 Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
19019956 2009 Efficient nuclear export of herpes simplex virus 1 transcripts requires both RNA binding by ICP27 and ICP27 interaction with TAP/NXF1.
18936162 2009 Fragile X mental retardation protein FMRP binds mRNAs in the nucleus.
18670889 2008 A structure refinement protocol combining NMR residual dipolar couplings and small angle scattering restraints.
18596238 2008 The DEAD-box RNA helicase DDX3 associates with export messenger ribonucleoproteins as well as tip-associated protein and participates in translational control.
18364396 2008 Mutually exclusive interactions drive handover of mRNA from export adaptors to TAP.
17978099 2008 Formation of a Tap/NXF1 homotypic complex is mediated through the amino-terminal domain of Tap and enhances interaction with nucleoporins.
17609285 2007 Kaposi's sarcoma-associated herpesvirus ORF57 protein enhances mRNA accumulation independently of effects on nuclear RNA export.
17333237 2007 XIST RNA exhibits nuclear retention and exhibits reduced association with the export factor TAP/NXF1.
17036044 2006 Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
17001072 2006 RNA-binding motif protein 15 binds to the RNA transport element RTE and provides a direct link to the NXF1 export pathway.
16971948 2006 An intron with a constitutive transport element is retained in a Tap messenger RNA.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15767397 2005 ICP27 recruits Aly/REF but not TAP/NXF1 to herpes simplex virus type 1 transcription sites although TAP/NXF1 is required for ICP27 export.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15210956 2004 A molecular link between SR protein dephosphorylation and mRNA export.
15184380 2004 Hypophosphorylated ASF/SF2 binds TAP and is present in messenger ribonucleoproteins.
14963046 2004 Conserved nuclear export sequences in Schizosaccharomyces pombe Mex67 and human TAP function in mRNA export by direct nuclear pore interactions.
14730019 2004 eIF4A3 is a novel component of the exon junction complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12581645 2003 Structural basis for the interaction between the Tap/NXF1 UBA domain and FG nucleoporins at 1A resolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384575 2002 Karyopherin beta 2B participates in mRNA export from the nucleus.
12093754 2002 The exon junction complex is detected on CBP80-bound but not eIF4E-bound mRNA in mammalian cells: dynamics of mRNP remodeling.
11875519 2002 Structure of the C-terminal FG-nucleoporin binding domain of Tap/NXF1.
11724776 2002 U2AF participates in the binding of TAP (NXF1) to mRNA.
11707413 2001 Magoh, a human homolog of Drosophila mago nashi protein, is a component of the splicing-dependent exon-exon junction complex.
11583626 2001 Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor.
11566096 2001 NXF5, a novel member of the nuclear RNA export factor family, is lost in a male patient with a syndromic form of mental retardation.
11551912 2001 In vitro analysis of nuclear transport mediated by the C-terminal shuttle domain of Tap.
11546874 2001 Communication of the position of exon-exon junctions to the mRNA surveillance machinery by the protein RNPS1.
11546873 2001 Role of the nonsense-mediated decay factor hUpf3 in the splicing-dependent exon-exon junction complex.
11259411 2001 Overexpression of TAP/p15 heterodimers bypasses nuclear retention and stimulates nuclear mRNA export.
11256625 2000 Prediction of structural domains of TAP reveals details of its interaction with p15 and nucleoporins.
11073998 2000 TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture.
11060011 2000 The structure of the mRNA export factor TAP reveals a cis arrangement of a non-canonical RNP domain and an LRR domain.
10924507 2000 Specific interaction between RNA helicase A and Tap, two cellular proteins that bind to the constitutive transport element of type D retrovirus.
10668806 2000 The C-terminal domain of TAP interacts with the nuclear pore complex and promotes export of specific CTE-bearing RNA substrates.
10454577 1999 Identification of novel import and export signals of human TAP, the protein that binds to the constitutive transport element of the type D retrovirus mRNAs.
10323864 1999 The human Tap protein is a nuclear mRNA export factor that contains novel RNA-binding and nucleocytoplasmic transport sequences.
10228171 1999 The Mex67p-mediated nuclear mRNA export pathway is conserved from yeast to human.
10202158 1999 TAP binds to the constitutive transport element (CTE) through a novel RNA-binding motif that is sufficient to promote CTE-dependent RNA export from the nucleus.
9933612 1999 The nuclear cap-binding complex is a novel target of growth factor receptor-coupled signal transduction.
9660949 1998 TAP, the human homolog of Mex67p, mediates CTE-dependent RNA export from the nucleus.
9175835 1997 Tap: a novel cellular protein that interacts with tip of herpesvirus saimiri and induces lymphocyte aggregation.
9166830 1997 The inv(11)(p15q22) chromosome translocation of de novo and therapy-related myeloid malignancies results in fusion of the nucleoporin gene, NUP98, with the putative RNA helicase gene, DDX10.