Property Summary

NCBI Gene PubMed Count 3
PubMed Score 6.31
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -4.300 1.8e-04
astrocytic glioma -3.200 6.5e-04
Astrocytoma, Pilocytic -4.100 7.5e-07
atypical teratoid / rhabdoid tumor -4.800 1.2e-09
cystic fibrosis 1.100 4.0e-04
ependymoma -3.500 5.5e-04
glioblastoma -4.100 4.3e-10
medulloblastoma -3.200 1.9e-02
medulloblastoma, large-cell -4.700 5.9e-04
oligodendroglioma -3.200 1.2e-03
primitive neuroectodermal tumor -4.400 1.8e-04
psoriasis 3.200 1.2e-156
subependymal giant cell astrocytoma -1.838 1.2e-02
ulcerative colitis -1.600 9.9e-05

Gene RIF (1)

AA Sequence

MWPAGAGTKLPCPRDSALRRAAFSGNLTALPSHLVPAGRSVRVFISANPEDTGAERQALRENVYPKLREF      1 - 70
CRENYGLEFQVIDLYWGVEEDEWDSPELQKTRMKLLENCLKTSAGPCFVGLLGEKYGNIRIPGEVEASEF     71 - 140
EMILDAAIEAKLETKLLEEWYCRDENSVPAAYYLRPKSEMLRSNRNAMQPSTNAENEKTWQEISDEIKKI    141 - 210
FKAAVKLLHEKGKMKHSQAKRYLFSAIEDEFDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMD    211 - 280
ITGTEPRIIRDPEAQEKLIKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDM    281 - 350
IDIIQATIQQNFDTETDTLYDEILQHSSLCKTYASFYEYKCESLNIVHNYILPSKAGHINPLIIYGGPCT    351 - 420
GKTLLLAEVAKKAYGWLHEDTGPESDPVVIVRFLGTTDMSSDLRTLLLSVCEQLAVNYRCLVQSYPKKIH    421 - 490
DLCDLFINLLNESSLQRPLVIIFDALEQLSENDDARKLWWLPAHLPRFVRIVLSTLPNKHGILQKLRCLI    491 - 560
HEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQQIYVNNALSKCTLPMFVNLTFREVRHWRSHKDVD    561 - 630
ESSLSVTVHESIEQLFWSLEKKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMSELKENTRPSNP    631 - 700
LRVPYLYIARLKEGLSGYLIERHVKNVTLLVWANRHLQLIAQKLYLQDDNDLREMHTILADYFLGVWSGG    701 - 770
RRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMSELLYH    771 - 840
LTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLANTLRSIKNKVTAFPGSL    841 - 910
SAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSPERLPLSSSHLHVTEILPTCNPS    911 - 980
TVLTALENGSISTWDVETRQLLRQITTAQSVILGMKLTSDEKYLVVATTNNTLLIYDNVNSCLLSEVEIK    981 - 1050
GTKHGSSATYINGFTLSANHALAWLEASKDVTVIDLLYGWPLYQFHCWYEVTCVQCSLDGLYAFCGQYLN   1051 - 1120
TTTIFHLGSGEKLCTVTSEFSGGFVKFLLILDTAQEMVMVDSEGSLSVWNTEDISSPQLTDDFDCRREDS   1121 - 1190
EVVSIELSEDQSAVLICKALSIELLDTGLWKVAEKFRAKHNERFISAVLSKNGDCIIATMENTSAVFFWR   1191 - 1260
RDTGQCMASLQEISGSIVKLVKSSHHNMLLSLSTSGVLSIWDIDIITAMSNIDKTGKPIQSLLLPARGEI   1261 - 1330
IYSLDGSDCVHKWNFSSGFIEAVFKHEGIVEHCVLTSTGDIMVTSDDKSSQYVWHTSSGENLFRINGQRI   1331 - 1400
SQLLITHNDQFVVSLCEENASRVWRLATGHRVCNILTTLQNAFITSANTFVVGMTKSKVLAVSLWTGSIT   1401 - 1470
KKFCCEDGTTIVNFKLIPDCPDIIVFITSAETVNIWSLTDEVICRRVQLPNNFLKNLEDFEISPNGKLGI   1471 - 1540
IARGDENINVLDLYSGKLRVVHASGIIWRQRLSRDGRYLVYICFRNGEEEDENGAIFSLIVMRLADGKNI   1541 - 1610
GACSLYKTPTFLALSQRHLNIIVGFDDGSIGIYTVVDRVDAALKIKIATSNSRQIFNNATHTSRPKCNSY   1611 - 1680
CFKISVDCLWRESTEVFARDSPITVSDSTESNEATPSKKHNSCYERVCSALEARGHSYAPDN           1681 - 1742
//

Text Mined References (5)

PMID Year Title