Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 4.1e-03
colon cancer 3.000 3.7e-03
ependymoma 4.000 1.2e-14
group 3 medulloblastoma 3.300 8.4e-05
intraductal papillary-mucinous neoplasm ... 1.600 6.5e-03
lung cancer -1.400 8.5e-03
malignant mesothelioma 5.100 1.4e-08
medulloblastoma, large-cell 1.100 4.5e-02
osteosarcoma -1.327 1.9e-03
primitive neuroectodermal tumor 2.200 2.2e-02

AA Sequence

MQFTSISNSLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQNQLLSRGFENLVPYTSTVSVVATP      1 - 70
VMTYGHLEGLINEWNLELEDQEKYFLLQATQVNAWDHTLIENGEMIRILHGEVNKVKLDQKRLEQELDFI     71 - 140
LSQQQELEFLLTYLEESTRDQSGLHYLQDADEEHVEISTRSAEF                              141 - 184
//

Text Mined References (9)

PMID Year Title