Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.51
PubTator Score 14.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.100 4.2e-02
psoriasis 1.500 5.3e-04
osteosarcoma 2.653 1.0e-06
atypical teratoid / rhabdoid tumor -1.400 1.0e-03
Atopic dermatitis 1.200 8.3e-05
intraductal papillary-mucinous adenoma (... 1.900 2.8e-03
intraductal papillary-mucinous carcinoma... 1.400 2.7e-02
lung cancer 1.100 3.3e-03
spina bifida -1.280 3.1e-02
ovarian cancer -1.700 6.4e-06

 GO Function (1)

Gene RIF (5)

PMID Text
23007389 analysis of the Nup153-Nup50 protein interface and its role in nuclear import
22130666 Nucleoporin Nup50 stabilizes closed conformation of armadillo repeat 10 in importin alpha5.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016008 Results suggest that Npap60L and Npap60S function differently in nuclear protein import.
18854154 Knockdown of nucleoporin 50kDa (NUP50) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGG      1 - 70
GRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQP     71 - 140
SSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSES    141 - 210
ESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSS    211 - 280
VLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVT    281 - 350
EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG    351 - 420
KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA                          421 - 468
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23007389 2012 The Nup153-Nup50 protein interface and its role in nuclear import.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22130666 2012 Nucleoporin Nup50 stabilizes closed conformation of armadillo repeat 10 in importin ?5.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20016008 2010 Two isoforms of Npap60 (Nup50) differentially regulate nuclear protein import.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16648475 2006 Nucleophosmin is essential for ribosomal protein L5 nuclear export.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12802065 2003 Direct interaction with nup153 mediates binding of Tpr to the periphery of the nuclear pore complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12361592 2002 Nucleocytoplasmic transport: more than the usual suspects.
12228227 2002 Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.
12176322 2002 Npap60/Nup50 is a tri-stable switch that stimulates importin-alpha:beta-mediated nuclear protein import.
10891500 2000 Characterization and targeted disruption of murine Nup50, a p27(Kip1)-interacting component of the nuclear pore complex.
10891499 2000 Nup50, a nucleoplasmically oriented nucleoporin with a role in nuclear protein export.
10601273 1999 Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.
10591208 1999 The DNA sequence of human chromosome 22.
10449902 1999 Mapping and complex expression pattern of the human NPAP60L nucleoporin gene.