Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.88
PubTator Score 14.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis 1.200 8.3e-05
atypical teratoid / rhabdoid tumor -1.400 1.0e-03
intraductal papillary-mucinous adenoma (... 1.500 5.6e-03
intraductal papillary-mucinous carcinoma... 1.400 2.7e-02
lung cancer 1.100 3.3e-03
osteosarcoma -2.183 3.7e-07
ovarian cancer -1.700 6.4e-06
psoriasis 1.500 5.3e-04
Rheumatoid arthritis 1.100 4.2e-02
spina bifida -1.280 3.1e-02

 GO Function (1)

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGG      1 - 70
GRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQP     71 - 140
SSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSES    141 - 210
ESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSS    211 - 280
VLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVT    281 - 350
EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG    351 - 420
KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA                          421 - 468
//

Text Mined References (33)

PMID Year Title