Property Summary

NCBI Gene PubMed Count 17
PubMed Score 105.29
PubTator Score 30.69

Knowledge Summary


No data available


  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 4.4e-04
atypical teratoid / rhabdoid tumor -1.400 2.2e-05
Breast cancer 3.200 3.5e-02
glioblastoma -1.100 1.8e-09
intraductal papillary-mucinous neoplasm ... -1.800 5.7e-03
invasive ductal carcinoma -1.154 2.5e-02
lung cancer 1.300 2.3e-02
medulloblastoma, large-cell -1.100 6.8e-04
osteosarcoma 2.877 8.2e-08
ovarian cancer -1.100 1.0e-04
pancreatic ductal adenocarcinoma liver m... -1.110 2.2e-02
Rheumatoid arthritis 1.600 1.1e-02
sonic hedgehog group medulloblastoma -1.200 2.0e-07
subependymal giant cell astrocytoma -1.298 4.5e-02

Gene RIF (3)

AA Sequence

ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR                                          141 - 172

Text Mined References (20)

PMID Year Title