Property Summary

NCBI Gene PubMed Count 17
PubMed Score 99.25
PubTator Score 30.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.600 1.1e-02
osteosarcoma 2.917 4.7e-06
glioblastoma -1.700 3.4e-05
atypical teratoid / rhabdoid tumor -1.600 9.8e-07
medulloblastoma, large-cell -1.700 5.8e-06
pancreatic ductal adenocarcinoma liver m... -1.110 2.2e-02
intraductal papillary-mucinous neoplasm ... -1.800 5.7e-03
lung cancer 1.300 2.3e-02
Breast cancer 3.200 3.5e-02
adult high grade glioma -1.600 6.4e-06
sonic hedgehog group medulloblastoma -1.200 2.0e-07
subependymal giant cell astrocytoma -1.298 4.5e-02
invasive ductal carcinoma -1.154 2.5e-02
ovarian cancer -1.100 1.0e-04

Synonym

Accession O95989 B2R8N4 DIPP-1
Symbols DIPP
DIPP1
DIPP-1

Gene

PANTHER Protein Class (2)

PDB

2FVV   2Q9P  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (3)

PMID Text
26932476 Nudt3 is an mRNA decapping enzyme that orchestrates expression of a subset of mRNAs to modulate cell migration and further substantiates the existence of multiple decapping enzymes functioning in distinct cellular pathways in mammals
23708086 results suggest that NUDT3 rs206936 is associated with body mass index in Japanese women
18854154 Knockdown of nudix (nucleoside diphosphate linked moiety X)-type motif 3 (NUDT3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEE      1 - 70
AGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYF     71 - 140
ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR                                          141 - 172
//

Text Mined References (20)

PMID Year Title
26932476 2016 Nudt3 is an mRNA decapping enzyme that modulates cell migration.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
23708086 2013 NUDT3 rs206936 is associated with body mass index in obese Japanese women.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19585659 2009 Crystal structure of human diphosphoinositol phosphatase 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370170 2002 Nudix hydrolases that degrade dinucleoside and diphosphoinositol polyphosphates also have 5-phosphoribosyl 1-pyrophosphate (PRPP) pyrophosphatase activity that generates the glycolytic activator ribose 1,5-bisphosphate.
10585413 1999 Site-directed mutagenesis of diphosphoinositol polyphosphate phosphohydrolase, a dual specificity NUDT enzyme that attacks diadenosine polyphosphates and diphosphoinositol polyphosphates.
10419486 1999 The diadenosine hexaphosphate hydrolases from Schizosaccharomyces pombe and Saccharomyces cerevisiae are homologues of the human diphosphoinositol polyphosphate phosphohydrolase. Overlapping substrate specificities in a MutT-type protein.
9822604 1998 A novel context for the 'MutT' module, a guardian of cell integrity, in a diphosphoinositol polyphosphate phosphohydrolase.