Property Summary

NCBI Gene PubMed Count 33
PubMed Score 52.29
PubTator Score 32.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Lissencephaly 61 5.332 2.7

Expression

Gene RIF (15)

PMID Text
27074040 NudC is co-localized with Aurora B at the midbody and co-immunoprecipitated with Aurora B in mitosis. results suggest that that dynamic phosphorylation of NudC by Aurora B regulates cytokinesis.
24069238 NudC acetylation/deacetylation regulates mitotic progression and NudC deacetylation, likely through HDAC3, is critical for spindle function and chromosome congression.
23364796 HIV-1 Tat upregulates the expression of nudC nuclear distribution protein (NUDC) in Jurkat cells
22190034 HIV-1 Tat upregulates the expression of nudC nuclear distribution protein (NUDC) in Jurkat cells
21473139 Human nuclear distribution C is found to be closely associated with cell malignant hyperplasia in nasopharyngeal carcinoma.
20675372 NudC may be involved in the regulation of LIS1 stability by its chaperone function.
20529857 separate binding sites on the Mpl receptor for TPO and hNUDC identified
19560457 Mpl plays an important and specific role in mediating hNUDC-induced megakaryocyte proliferation and differentiation.
18288130 hNUDC induced a sustained activation of the extracellular signal-regulated protein kinases-1 and -2 (ERK1/2) as well as p38 mitogen-activated kinase (p38 MAPK) pathways
17658515 hNUDC induced significant changes in cellular morphology in NIH 3T3 cells stably transfected with pMpl-EGFP. Interestingly, these morphological changes were characteristic of cells undergoing megakaryocyte differentiation.
16860740 NudC functions as both a substrate and a spatial regulator of Plk1 at the kinetochore to promote chromosome congression.
16088917 In this study, we report the binding of hNUDC to the extracellular domain of the thrombopoietin receptor (Mpl) as detected by the yeast two-hybrid system, GST pull-down, and co-immunoprecipitation.
14676831 Overexpression of NUDC inhibits prostatic neoplasm growth.
12852857 PLK1 phosphorylation of NudC plays an essential role in cytokinesis.
12679384 functions in mitosis and cytokinesis, in part by regulating microtubule organization at the midzone and midbody

AA Sequence

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTR      1 - 70
REKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSP     71 - 140
GKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVG    141 - 210
LKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLD    211 - 280
SETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN                       281 - 331
//

Text Mined References (42)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27074040 2016 Dynamic Phosphorylation of NudC by Aurora B in Cytokinesis.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24069238 2013 NudC deacetylation regulates mitotic progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21473139 2011 [Expression and clinical significance of human nuclear distribution C in nasopharyngeal carcinoma].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20675372 2010 The L279P mutation of nuclear distribution gene C (NudC) influences its chaperone activity and lissencephaly protein 1 (LIS1) stability.
20529857 2010 Identification of the residues in the extracellular domain of thrombopoietin receptor involved in the binding of thrombopoietin and a nuclear distribution protein (human NUDC).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19560457 2009 Interference RNA (RNAi)-based silencing of endogenous thrombopoietin receptor (Mpl) in Dami cells resulted in decreased hNUDC-mediated megakaryocyte proliferation and differentiation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18288130 2008 hNUDC promotes the cell proliferation and differentiation in a leukemic cell line via activation of the thrombopoietin receptor (Mpl).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17658515 2007 Regulation of cell differentiation by hNUDC via a Mpl-dependent mechanism in NIH 3T3 cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16860740 2006 NudC is required for Plk1 targeting to the kinetochore and chromosome congression.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16088917 2005 A microtubule associated protein (hNUDC) binds to the extracellular domain of thrombopoietin receptor (Mpl).
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14676831 2004 Inhibition of prostate tumor growth by overexpression of NudC, a microtubule motor-associated protein.
12852857 2003 A role for Plk1 phosphorylation of NudC in cytokinesis.
12679384 2003 Role for NudC, a dynein-associated nuclear movement protein, in mitosis and cytokinesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11734602 2001 NudC associates with Lis1 and the dynein motor at the leading pole of neurons.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10453739 1999 Molecular cloning and characterization of the human NUDC gene.
10210332 1999 A homolog of the fungal nuclear migration gene nudC is involved in normal and malignant human hematopoiesis.
9601647 1998 The lissencephaly gene product Lis1, a protein involved in neuronal migration, interacts with a nuclear movement protein, NudC.