Property Summary

NCBI Gene PubMed Count 16
PubMed Score 57.95
PubTator Score 32.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.765 2.2e-04
ovarian cancer -1.100 8.9e-06

Gene RIF (7)

AA Sequence

MGIWQRLLLFGGVSLRAGGGATAPLGGSRAMVCGRQLSGAGSETLKQRRTQIMSRGLPKQKPIEGVKQVI      1 - 70
VVASGKGGVGKSTTAVNLALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGNPELSQSNLMRPLLNYGIA     71 - 140
CMSMGFLVEESEPVVWRGLMVMSAIEKLLRQVDWGQLDYLVVDMPPGTGDVQLSVSQNIPITGAVIVSTP    141 - 210
QDIALMDAHKGAEMFRRVHVPVLGLVQNMSVFQCPKCKHKTHIFGADGARKLAQTLGLEVLGDIPLHLNI    211 - 280
REASDTGQPIVFSQPESDEAKAYLRIAVEVVRRLPSPSE                                   281 - 319
//

Text Mined References (18)

PMID Year Title