Property Summary

NCBI Gene PubMed Count 54
PubMed Score 33.01
PubTator Score 15.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -3.400 5.3e-09
astrocytic glioma -2.600 3.1e-03
ependymoma -3.900 1.3e-15
oligodendroglioma -2.500 9.1e-16
glioblastoma -3.800 2.2e-06
osteosarcoma -1.916 2.1e-03
sonic hedgehog group medulloblastoma -4.800 1.1e-11
cystic fibrosis -3.165 4.5e-07
atypical teratoid / rhabdoid tumor -4.100 1.1e-09
medulloblastoma, large-cell -4.700 3.4e-07
primitive neuroectodermal tumor -2.300 1.9e-02
intraductal papillary-mucinous adenoma (... -1.400 1.5e-02
intraductal papillary-mucinous carcinoma... -1.900 7.6e-04
intraductal papillary-mucinous neoplasm ... -2.100 3.0e-03
lung cancer 2.800 1.4e-05
colon cancer -1.600 2.4e-03
interstitial cystitis 1.400 2.3e-02
lung adenocarcinoma -1.100 2.0e-08
adult high grade glioma -3.900 7.3e-09
pilocytic astrocytoma -2.000 9.9e-06
subependymal giant cell astrocytoma -1.982 4.5e-02
Breast cancer 1.400 4.4e-02
Endometriosis -1.034 3.8e-02
Pick disease -1.900 2.8e-02
ovarian cancer -3.100 2.7e-07
psoriasis -1.400 6.7e-74

Gene RIF (31)

PMID Text
25450229 The rare variants in NRXN3 were significantly associated with smoking status.
24469609 This study confirmed the genetic heterogeneity of cluster headache, suggesting that a novel rearrangement involving NRXN3 gene might be related to cluster headache in a subset of cases
24444492 The study showed that markers rs2217887 (NRXN3) showed weak associations.
24265751 a positive association between Neurexin 3 and controls in the Han Chinese population, and genetic evidence to support the susceptibility of DEACMP
23909413 Neurexin 3-alpha (NRXN3) is a synaptic cell-cell adhesion molecule involved in maintenance of neural connections (such as the maintenance of smoking behavior).
23383267 FoxQ1 promotes glioma cell proliferation and migration by down-regulation of NRXN3 expression.
23306218 Our findings suggested that NRXN3 might represent a major susceptibility gene for schizophrenia
23245376 the study finds preliminary evidence for the association of NRXN3 with Borderline Personality Disorder phenotypes. The strongest association with positive screening for BPD was found for SNP rs10083466.
23118423 Association of the Graves disease phenotype with two markers, rs12147587 and rs2284720, located within the NRXN3 and TSHR genes, respectively.
22716474 NRXN3 polymorphisms play a role in susceptibility to smoking behavior and are strongly implicated in human genetic vulnerability to addictive behaviors.
22391885 By age 7, common variations in FTO, TMEM18 and NRXN3 influence the vulnerability to metabolic complications of sleep deprivation.
22209245 Index cases of autism spectrum were clinically characterized who have rare microdeletions at 14q24.3-31.1, a region that overlaps exons of the alpha and/or beta isoforms of NRXN3.
21688152 NRXN3 single nucleotide polymorphism rs10146997 was significantly (P = 0.0445) associated with higher risk of breast cancer development (OR = 0.66 (95% CI 0.44-0.99)).
21676558 Six NRXN3 polymorphisms were genotyped: rs983795, rs11624704, rs917906, rs1004212, rs10146997 and rs8019381 associated with impulsivity and substance abuse.
21674055 central obesity-associated variants in LYPLAL1, NRXN3, MSRA, and TFAP2B
21358552 Our results reveal that menopause influences the adipose tissue expression of many genes, especially of neurexin 3, metallothionein 1E, and keratyn 7, which are associated with the alteration of several key biological processes.
21084300 alpha- and gamma-secretases can sequentially process NRXN3beta, leading to the formation of two final products, an approximately 80-kDa N-terminal extracellular domain of Neurexin-3beta (sNRXN3beta) and an approximately 12-kDa C-terminal intracellular NRXN3beta domain (NRXN3beta-ICD)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20703240 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19658047 Association of a polymorphism in the NRXN3 gene with the degree of smoking in schizophrenia.
19557197 Variants in NRXN3 are associated with waist circumference, body mass index and obesity.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17804423 Observational study of gene-disease association. (HuGE Navigator)
17804423 details of NRXN3's gene structure and variants, and association of NRXN3 SNPs with alcohol dependence
12379233 Identification and characterization of heart-specific splicing of neurexin 3 mRNA
9856994 N-terminal sequencing of rat neurexin III alpha provides evidence for signal peptide
8163501 N-terminal sequencing of cow neurexin III beta provides evidence for signal peptide

AA Sequence

MHLRIHARRSPPRRPAWTLGIWFLFWGCIVSSVWSSSNVASSSSTSSSPGSHSQHEHHFHGSKHHSVPIS      1 - 70
IYRSPVSLRGGHAGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDFLQ     71 - 140
LHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEHYPTGRQLTIFNTQ    141 - 210
AQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTT    211 - 280
VMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPSTGGELVIPLLVEDPLATPPIAT    281 - 350
RAPSITLPPTFRPLLTIIETTKDSLSMTSEAGLPCLSDQGSDGCDDDGLVISGYGSGETFDSNLPPTDDE    351 - 420
DFYTTFSLVTDKSLSTSIFEGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELIRFTASSSSGMVPKL    421 - 490
PAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTANPTEPGIRRVPGASEVIRESSS    491 - 560
TTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKN    561 - 630
KDREYYV                                                                   631 - 637
//

Text Mined References (57)

PMID Year Title
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24469609 2015 Molecular analysis of cluster headache.
24444492 2014 Identification of novel loci for bipolar I disorder in a multi-stage genome-wide association study.
24265751 2013 DNA pooling base genome-wide association study identifies variants at NRXN3 associated with delayed encephalopathy after acute carbon monoxide poisoning.
23909413 2013 Gene × smoking interactions on human brain gene expression: finding common mechanisms in adolescents and adults.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23383267 2013 FoxQ1 promotes glioma cells proliferation and migration by regulating NRXN3 expression.
23306218 2013 Association study of NRXN3 polymorphisms with schizophrenia and risperidone-induced bodyweight gain in Chinese Han population.
23245376 2013 Examining the association of NRXN3 SNPs with borderline personality disorder phenotypes in heroin dependent cases and socio-economically disadvantaged controls.
23118423 2013 Fine mapping of loci linked to autoimmune thyroid disease identifies novel susceptibility genes.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
22872573 2012 Genome-wide association study of prognosis in advanced non-small cell lung cancer patients receiving platinum-based chemotherapy.
22716474 2012 Association of neurexin 3 polymorphisms with smoking behavior.
22391885 2013 Variations in the obesity genes FTO, TMEM18 and NRXN3 influence the vulnerability of children to weight gain induced by short sleep duration.
22209245 2012 Rare deletions at the neurexin 3 locus in autism spectrum disorder.
21688152 2012 Influence of genomic variation in FTO at 16q12.2, MC4R at 18q22 and NRXN3 at 14q31 genes on breast cancer risk.
21676558 2011 Associations among types of impulsivity, substance use problems and neurexin-3 polymorphisms.
21674055 2011 Implications of central obesity-related variants in LYPLAL1, NRXN3, MSRA, and TFAP2B on quantitative metabolic traits in adult Danes.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21358552 2011 Profile of adipose tissue gene expression in premenopausal and postmenopausal women: site-specific differences.
21084300 2011 Processing of the synaptic cell adhesion molecule neurexin-3beta by Alzheimer disease alpha- and gamma-secretases.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20703240 2010 Polymorphisms in NRXN3, TFAP2B, MSRA, LYPLAL1, FTO and MC4R and their effect on visceral fat area in the Japanese population.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20197096 2010 Genome-wide analysis reveals novel genes influencing temporal lobe structure with relevance to neurodegeneration in Alzheimer's disease.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19926856 2009 The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions.
19658047 2009 Association of a polymorphism in the NRXN3 gene with the degree of smoking in schizophrenia: a preliminary study.
19557197 2009 NRXN3 is a novel locus for waist circumference: a genome-wide association study from the CHARGE Consortium.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18923512 2008 Neuroligins and neurexins link synaptic function to cognitive disease.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17804423 2007 Neurexin 3 polymorphisms are associated with alcohol dependence and altered expression of specific isoforms.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379233 2002 Identification and characterization of heart-specific splicing of human neurexin 3 mRNA (NRXN3).
12036300 2002 Structure and evolution of neurexin genes: insight into the mechanism of alternative splicing.
11944992 2002 Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9856994 1998 Neurexophilin binding to alpha-neurexins. A single LNS domain functions as an independently folding ligand-binding unit.
9707552 1998 PDZ-domain-mediated interaction of the Eph-related receptor tyrosine kinase EphB3 and the ras-binding protein AF6 depends on the kinase activity of the receptor.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9448462 1998 Neurexins: three genes and 1001 products.
8786425 1996 CASK: a novel dlg/PSD95 homolog with an N-terminal calmodulin-dependent protein kinase domain identified by interaction with neurexins.
8576240 1996 Structures, alternative splicing, and neurexin binding of multiple neuroligins.
8163501 1994 Conserved domain structure of beta-neurexins. Unusual cleaved signal sequences in receptor-like neuronal cell-surface proteins.