Property Summary

NCBI Gene PubMed Count 25
PubMed Score 9.17
PubTator Score 5.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gout 93 0.0 2.0
Kidney disease 397 0.0 2.0

Expression

Gene RIF (5)

PMID Text
25450229 The rare variants in NRXN2 were significantly associated with smoking status.
21424692 Truncating mutations in NRXN2 is associated with autism spectrum disorders and schizophrenia
20634891 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPGGSGPGGCPRRPPALAGPLPPPPPPPPPPLLPLLPLLLLLLLGAAEGARVSSSLSTTHHVHHFHSKH      1 - 70
GTVPIAINRMPFLTRGGHAGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASG     71 - 140
LGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFD    141 - 210
NERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAE    211 - 280
SDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDDL    281 - 350
LVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPFVPPPPTFYPFLTGVGATQDTLPPP    351 - 420
AARRPPSGGPCQAERDDSDCEEPIEASGFASGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRP    421 - 490
NLRTDGATGAPGVLFAPSAPAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGF    491 - 560
PHLPTANPTGPGERGPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNY    561 - 630
ISNSAQSNGAVVKEKAPAAPKTPSKAKKNKDKEYYV                                      631 - 666
//

Text Mined References (25)

PMID Year Title
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
21768215 2011 Genome-wide association study for serum urate concentrations and gout among African Americans identifies genomic risk loci and a novel URAT1 loss-of-function allele.
21424692 2011 Truncating mutations in NRXN2 and NRXN1 in autism spectrum disorders and schizophrenia.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18923512 2008 Neuroligins and neurexins link synaptic function to cognitive disease.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15491607 2004 Alternative splice variants encoding unstable protein domains exist in the human brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12036300 2002 Structure and evolution of neurexin genes: insight into the mechanism of alternative splicing.
11944992 2002 Analysis of the human neurexin genes: alternative splicing and the generation of protein diversity.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9888998 1999 A 500-kb sequence-ready cosmid contig and transcript map of the MEN1 region on 11q13.
9707552 1998 PDZ-domain-mediated interaction of the Eph-related receptor tyrosine kinase EphB3 and the ras-binding protein AF6 depends on the kinase activity of the receptor.
9647694 1998 CIPP, a novel multivalent PDZ domain protein, selectively interacts with Kir4.0 family members, NMDA receptor subunits, neurexins, and neuroligins.
8786425 1996 CASK: a novel dlg/PSD95 homolog with an N-terminal calmodulin-dependent protein kinase domain identified by interaction with neurexins.
8576240 1996 Structures, alternative splicing, and neurexin binding of multiple neuroligins.
1621094 1992 Neurexins: synaptic cell surface proteins related to the alpha-latrotoxin receptor and laminin.