Property Summary

NCBI Gene PubMed Count 91
PubMed Score 115.96
PubTator Score 167.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma -5.700 3.6e-09
astrocytoma 1.500 1.3e-11
glioblastoma 2.800 1.2e-04
oligodendroglioma 1.300 1.3e-08
osteosarcoma 3.716 8.3e-05
cystic fibrosis 4.453 6.3e-09
atypical teratoid / rhabdoid tumor 2.300 5.2e-04
medulloblastoma, large-cell 2.400 7.6e-03
primitive neuroectodermal tumor 1.800 3.8e-03
adrenocortical carcinoma -1.346 1.2e-02
tuberculosis -1.700 2.2e-05
intraductal papillary-mucinous neoplasm ... 2.800 2.3e-03
lung cancer 2.600 4.2e-03
colon cancer -2.600 2.9e-05
pancreatic cancer 1.200 3.9e-03
Breast cancer 4.500 2.2e-02
interstitial cystitis 1.400 2.9e-02
pediatric high grade glioma 2.600 4.3e-05
pilocytic astrocytoma 2.000 2.4e-05
posterior fossa group A ependymoma 1.200 8.5e-03
aldosterone-producing adenoma -1.127 3.0e-02
subependymal giant cell astrocytoma 3.803 3.6e-03
invasive ductal carcinoma 1.383 1.3e-02
lung carcinoma -2.400 2.6e-22
gastric carcinoma 1.900 2.5e-02
mucosa-associated lymphoid tissue lympho... 2.021 4.8e-02
ovarian cancer 2.400 4.6e-06

Protein-protein Interaction (1)

Gene RIF (69)

PMID Text
26884342 Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans.
26753562 the concurrent high expression of VEGF-C and NRP2 is predictive of the unfavorable prognosis in glioblastoma.
26560516 NRP2/WDFY1 axis is required for maintaining endocytic activity in cancer cells, which supports their oncogenic activities and confers drug resistance.
26286962 Data show significant increases in semaphorin3C, 3D and their receptor neuropilin-2 in degenerate samples which were shown to contain nerves and blood vessels, compared to non-degenerate samples without nerves and blood vessels.
26156437 SEMA3F-NRP2 interactions inhibit intracellular PI-3K activity, mTORC2-dependent signaling, RhoA activity and cytoskeletal stress fiber formation.
26030152 the novel interplay between PAX8 and Neuropilin-2
26026587 This is the first study in the literature showing that neuropilin-2 and ezrin are related with prognosis in patients with advanced renal cell carcinoma.
25890345 Neuropilin-2 expression is inhibited by secreted Wnt antagonists and its down-regulation is associated with reduced tumor growth and metastasis in osteosarcoma
25543087 Neuropilin-2 mediates lymphangiogenesis of colorectal carcinoma via a VEGFC/VEGFR3 independent signaling.
25315821 Data show that the transmembrane (TM)domains of neuropilins 1 and 2 dimerize with themselves.
25068647 Data indicate that semaphorin 3F (SEMA3F) and its receptor neuropilin-2 (NRP2) are expressed in the thymus.
24862180 High NRP2 expression is associated with bladder cancer.
24729581 This is the first report of a targeted MRI molecular probe based on USPIO and VEGF165-aptamer.
24522185 Paxillin knockdown increases capillary endothelial cell migration and invasiveness, and thereby enhances microvessel ingrowth, by suppressing NRP2 expression.
24359286 This preliminary study strongly supports the significance of NRP2 as a useful biomarker for malignant progression of melanoma, which may be useful for early identification of patients with melanoma at high risk.
24162774 HIV-1 gp120 upregulates the expression of neuropilin 2 (NRP2) in human B cells
24121493 NRP2 contributes significantly to TGF-beta1-induced epithelial-mesenchymal transition in lung cancer.
23892628 GATA2 and Lmo2 cooperatively regulate VEGF-induced angiogenesis and lymphangiogenesis via NRP2.
23801331 ST8SiaIV synthesized polySia selectively on a NRP2 glycoform that was characterized by the presence of sialylated core 1 and core 2 O-glycans.
23585340 Dysregulated expression of NRP-2 likely contributes to altered angiogenesis, lymphangiogenesis, neurogenesis and immune function in endometriosis.
23551578 An increase in NRP1 and NRP2 epithelial/tumour expression, as well as in NRP1 vascular expression, may be associated with disease progression in colorectal cancer.
23436775 GLI1 regulates the neuropilin-2/alpha6beta1 integrin based autocrine pathway that contributes to breast cancer initiation.
23149913 These data suggest a link between the VEGF-C/NRP-2 axis and cancer cell survival
23145112 Utilizing the information on Nrp ligand binding specificity, we demonstrate Nrp constructs that specifically sequester Sema3 in the presence of VEGF-A
23076131 Neuropilin 2 enables the function of specific integrins that contribute to tumor initiation and progression. [review]
22971992 Inhibition of VEGF by EGCG was associated with suppression of neuropilin-2.
22961441 NRP2 and VEGFR-3 mRNA levels were significantly higher in some of the vascular malformations endothelial cells.
22777769 the VEGF receptor NRP2 is induced by PTEN loss and VEGF/NRP2 signaling regulates the expression of Bmi-1, a key effector of prostate tumorigenesis induced by PTEN deletion
22384800 In the majority of lung, breast and colorectal cancers, the effects of anti-neuropilin-2 are likely to be restricted to the vasculature
22028766 tumor cell-derived NRP-2 mediates critical survival signaling in gastrointestinal cancer cells
21880798 Nrp2 expression was correlated with lymph node metastasis and VEGF-D expression in papillary thyroid carcinoma. Our data also showed a role for Nrp2 in regulating VEGF-D-induced invasion and migration in vitro.
21840568 In tumoral tissue, consistently strong staining of Neuropilin-2 was noted only in renal cell carcinoma but not in any of the other tumors studied.
21747928 a direct role of NRP2 in epithelial-mesenchymal transition and highlight a cross-talk between neuropilin-2 and TGF-beta1 signaling to promote cancer progression
21610314 It was concluded that hypoxia regulates VEGF and SE MA3F activities through transcriptional repression of their common receptor NRP2, providing a novel mechanism by which hypoxia induces tumor angiogenesis, growth and metastasis.
21474827 Vascular endothelial growth factor-D stimulates endothelial cell VEGF-A, stanniocalcin-1, and neuropilin-2 and has potent angiogenic effects.
21324919 A critical role of NRP2 in coordinated cell patterning and growth was confirmed using the coculture system. We conclude that NRP2 represents an important mediator of melanoma-endothelial interactions.
21199821 dendritic cells express the NRP2 isoforms NRP2a and NRP2b, both are susceptible to polysialylation which is required to specifically enhance chemotaxis toward CCL21
20851535 Expression of Nrp2 protein is significantly correlated with tumor progression and angiogenesis in salivary adenoid cystic carcinomas.
20651020 Mutated soluble neuropilin-2 B domain antagonizes vascular endothelial growth factor bioactivity and inhibits tumor progression.
20548225 BMSCs transfected with reconstructed plasmid pIRES-hBMP-2-VEGF165 could secret a high level of BMP-2 and hVEGF165.
20488940 Polysialyted NRP2 enhances dendritic cell migration through the basic c-terminal region of CCL21.
19855168 NRP2 is necessary to trigger Sema3A-induced glioma cell repulsion and attraction.
19790074 Soluble neuropilin-2 has no antirepellent activity but aggravates sympathetic nerve fiber repulsion and arthritis. Increased shedding of neuropilin-2 is probably an unfavorable sign in rheumatoid arthritis.
19736548 This is the first report suggesting a differential role of NRP1 and NRP2 in renal fibrogenesis.
19580679 Neuropilin-2 in breast cancer has a role in lymph node metastasis, poor prognosis, and regulation of CXCR4 expression
19480842 Data show that the expression of Sema3A receptors (neuropilin-1 (NRP-1), NRP-2, plexin A1, plexin A2, and plexin A3) significantly increased during M-CSF-mediated differentiation of monocytes into macrophages.
19474288 Intra-amniotic infection upregulates decidual cell vascular endothelial growth factor (VEGF) and neuropilin-1 and -2 expression: implications for infection-related preterm birth.
19460752 Knockdown of neuropilin 2 (NRP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19409892 Data suggest that neuropilin 2 may increase the response to VEGF, which is more significant in gastric tumor endothelial cells (TEC) than in normal cells, leading to gastric TEC with aggressive angiogenesis phenotypes.
19088020 Reduction of NRP-2 expression in pancreatic ductal adenocarcinoma cells decreased survival signaling, migration, invasion, and ability to grow under anchorage-independent conditions.
19037249 Transcripts of both NRP1 and NRP2 were found to be decreased in renal biopsies from patients with diabetic nephropathy
18785001 Observational study of gene-disease association. (HuGE Navigator)
18781179 In gliomas, SEMA3B, SEMA3G and NRP2 expressions were related to prolonged survival
18708346 hypoxia and nutrient deprivation stimulate the rapid loss of NRP1 expression in both endothelial and carcinoma cells. NRP2 expression, in contrast, is maintained under these conditions
18564921 Observational study of gene-disease association. (HuGE Navigator)
18307536 IL-8 might be a malignant factor in human pancreatic cancer by induction of vascular endothelial growth factor and NRP-2 expression and ERK activation.
18182619 NRP2 expression enhances cell survival, migration, invasion, and in vivo tumor growth and it may be a promising therapeutic target for colorectal cancer.
18065694 Both NRP1 and NRP2 function as proangiogenic coreceptors, potentiating the activity of at least 2 proangiogenic cytokines, VEGF-A and hepatocyte grwoth factor.
17917967 neoplastic cells in myeloid leukemias frequently express VEGFR including NRP-1 and NRP-2
17891484 Observational study of gene-disease association. (HuGE Navigator)
17699524 that neuropilin-2 (NRP-2), a receptor for the semaphorin and vascular endothelial growth factor families in neurons and endothelial cells, respectively, is expressed on the surface of human dendritic cells and is polysialylated.
17427189 Observational study of gene-disease association. (HuGE Navigator)
17427189 The polymorphisms in the NRP2 gene are associated with autism, implying that the NRP2 gene may render individuals to be predisposed to autism.
17088944 These results suggest that the expression of VEGFRs and NRPs on keratinocytes may constitute important regulators for its activity and may possibly be responsible for the autocrine signaling in the epidermis.
16816121 NP2 is directly involved in an active signaling complex with the key regulators of lymphangiogenesis.
16621967 NRP2 acts as a coreceptor that enhances human endothelial cell biological responses induced by VEGF-A and VEGF-C.
15613413 NP-2 mRNA, in endothelium, was expressed only by the endothelium of veins, and in these cells, its expression was hormonally regulated in the converse manner: it was very low during the proliferative phase and high during the secretory phase
14760080 Np-1 and Np-2 contribute to autocrine-paracrine interactions in pancreatic cancer
12730958 human glioma cells express class 3 semaphorins and receptors for soluble and membrane-bound semaphorins, suggesting a possible role of the semaphorin/neuropilin system in the interactions of human malignant glioma with the nervous and immune systems.

AA Sequence

MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVL      1 - 70
NFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIRFTSDYARQGAGFSLRYE     71 - 140
IFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKY    141 - 210
DWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVP    211 - 280
LGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISR    281 - 350
ETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL    351 - 420
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQV    421 - 490
DLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDI    491 - 560
RRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENC    561 - 630
SFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYA    631 - 700
RLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQI    701 - 770
VFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS    771 - 840
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNF    841 - 910
ELYDGLKHKVKMNHQKCCSEA                                                     911 - 931
//

Text Mined References (96)

PMID Year Title
26884342 2016 Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans.
26753562 2016 Concurrent Expression of VEGF-C and Neuropilin-2 Is Correlated with Poor Prognosis in Glioblastoma.
26560516 2016 Neuropilin-2 Regulates Endosome Maturation and EGFR Trafficking to Support Cancer Cell Pathobiology.
26286962 2015 Class 3 semaphorins expression and association with innervation and angiogenesis within the degenerate human intervertebral disc.
26156437 2015 Regulation of mTOR Signaling by Semaphorin 3F-Neuropilin 2 Interactions In Vitro and In Vivo.
26030152 2015 Neuropilin-2 Is a Newly Identified Target of PAX8 in Thyroid Cells.
26026587 2015 The impact of immunohistochemical staining with ezrin-carbonic anhydrase IX and neuropilin-2 on prognosis in patients with metastatic renal cell cancer receiving tyrosine kinase inhibitors.
25890345 2015 Neuropilin-2 expression is inhibited by secreted Wnt antagonists and its down-regulation is associated with reduced tumor growth and metastasis in osteosarcoma.
25543087 2015 Neuropilin-2 mediates lymphangiogenesis of colorectal carcinoma via a VEGFC/VEGFR3 independent signaling.
25315821 2014 Evidence for new homotypic and heterotypic interactions between transmembrane helices of proteins involved in receptor tyrosine kinase and neuropilin signaling.
25068647 2014 Semaphorin 3F and neuropilin-2 control the migration of human T-cell precursors.
24862180 2015 Neuropilin-2 and its ligand VEGF-C predict treatment response after transurethral resection and radiochemotherapy in bladder cancer patients.
24729581 Molecular magnetic resonance probe targeting VEGF165: preparation and in vitro and in vivo evaluation.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24522185 2014 Paxillin controls endothelial cell migration and tumor angiogenesis by altering neuropilin 2 expression.
24359286 2014 Neuropilin-2 gene expression correlates with malignant progression in cutaneous melanoma.
24121493 2013 Neuropilin-2 Is upregulated in lung cancer cells during TGF-?1-induced epithelial-mesenchymal transition.
23892628 2013 GATA2 and Lmo2 control angiogenesis and lymphangiogenesis via direct transcriptional regulation of neuropilin-2.
23801331 2013 Polysialic acid on neuropilin-2 is exclusively synthesized by the polysialyltransferase ST8SiaIV and attached to mucin-type o-glycans located between the b2 and c domain.
23585340 2013 Dysregulation of vascular endothelial growth factors and their neuropilin receptors in the eutopic endometrium of women with endometriosis.
23551578 2013 Neuropilin-1 and neuropilin-2 expression in the adenoma-carcinoma sequence of colorectal cancer.
23436775 2013 GLI1 regulates a novel neuropilin-2/?6?1 integrin based autocrine pathway that contributes to breast cancer initiation.
23149913 2013 Autophagy control by the VEGF-C/NRP-2 axis in cancer and its implication for treatment resistance.
23145112 2012 Mechanism of selective VEGF-A binding by neuropilin-1 reveals a basis for specific ligand inhibition.
23076131 Enhancing integrin function by VEGF/neuropilin signaling: implications for tumor biology.
22971992 2013 EGCG inhibits growth of human pancreatic tumors orthotopically implanted in Balb C nude mice through modulation of FKHRL1/FOXO3a and neuropilin.
22961441 2013 Neuropilin-2 and vascular endothelial growth factor receptor-3 are up-regulated in human vascular malformations.
22777769 2012 VEGF/neuropilin-2 regulation of Bmi-1 and consequent repression of IGF-IR define a novel mechanism of aggressive prostate cancer.
22384800 2012 Neuropilin-2 expression in cancer.
22365152 2012 De novo pathogenic SCN8A mutation identified by whole-genome sequencing of a family quartet affected by infantile epileptic encephalopathy and SUDEP.
22028766 2011 Neuropilin-2 mediated ?-catenin signaling and survival in human gastro-intestinal cancer cell lines.
21880798 2011 Neuropilin-2 expression in papillary thyroid carcinoma: correlation with VEGF-D expression, lymph node metastasis, and VEGF-D-induced aggressive cancer cell phenotype.
21840568 2012 Neuropilin-2: a novel biomarker for malignant melanoma?
21747928 2011 Neuropilin-2 expression promotes TGF-?1-mediated epithelial to mesenchymal transition in colorectal cancer cells.
21610314 Hypoxia induces tumor and endothelial cell migration in a semaphorin 3F- and VEGF-dependent manner via transcriptional repression of their common receptor neuropilin 2.
21474827 2011 Vascular endothelial growth factor (VEGF)-D stimulates VEGF-A, stanniocalcin-1, and neuropilin-2 and has potent angiogenic effects.
21324919 2011 Integration of genotypic and phenotypic screening reveals molecular mediators of melanoma-stromal interaction.
21245381 2011 Neuropilin-1 signaling through p130Cas tyrosine phosphorylation is essential for growth factor-dependent migration of glioma and endothelial cells.
21199821 2011 Polysialic acid is required for neuropilin-2a/b-mediated control of CCL21-driven chemotaxis of mature dendritic cells and for their migration in vivo.
20851535 2010 Expression of Neuropilin-2 in salivary adenoid cystic carcinoma: its implication in tumor progression and angiogenesis.
20651020 2010 A mutated soluble neuropilin-2 B domain antagonizes vascular endothelial growth factor bioactivity and inhibits tumor progression.
20548225 2010 Influence on the osteogenic activity of the human bone marrow mesenchymal stem cells transfected by liposome-mediated recombinant plasmid pIRES-hBMP2-hVEGF165 in vitro.
20488940 2010 Polysialylated neuropilin-2 enhances human dendritic cell migration through the basic C-terminal region of CCL21.
19909241 2009 The role of neuropilins in cell signalling.
19855168 Neuropilin-2 acts as a modulator of Sema3A-dependent glioma cell migration.
19790074 2009 Soluble neuropilin-2, a nerve repellent receptor, is increased in rheumatoid arthritis synovium and aggravates sympathetic fiber repulsion and arthritis.
19736548 2009 Neuropilin-1 and neuropilin-2 are differentially expressed in human proteinuric nephropathies and cytokine-stimulated proximal tubular cells.
19580679 2009 Neuropilin-2 expression in breast cancer: correlation with lymph node metastasis, poor prognosis, and regulation of CXCR4 expression.
19480842 2009 Expression and function of semaphorin 3A and its receptors in human monocyte-derived macrophages.
19474288 2009 Intra-amniotic infection upregulates decidual cell vascular endothelial growth factor (VEGF) and neuropilin-1 and -2 expression: implications for infection-related preterm birth.
19409892 2009 Neuropilin2 expressed in gastric cancer endothelial cells increases the proliferation and migration of endothelial cells in response to VEGF.
19088020 2008 Neuropilin-2-mediated tumor growth and angiogenesis in pancreatic adenocarcinoma.
19037249 2009 Advanced glycation end-products suppress neuropilin-1 expression in podocytes.
18785001 2009 Exploratory study evaluating the association of polymorphisms of angiogenesis genes with hot flashes.
18781179 2008 Semaphorin, neuropilin and VEGF expression in glial tumours: SEMA3G, a prognostic marker?
18708346 2008 Metabolic stress induces the lysosomal degradation of neuropilin-1 but not neuropilin-2.
18564921 2008 Candidate gene analysis in primary lymphedema.
18307536 2008 Interleukin-8 increases vascular endothelial growth factor and neuropilin expression and stimulates ERK activation in human pancreatic cancer.
18182619 2008 Therapeutic targeting of neuropilin-2 on colorectal carcinoma cells implanted in the murine liver.
18065694 2008 Neuropilin-1 and neuropilin-2 act as coreceptors, potentiating proangiogenic activity.
17989695 2007 Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding.
17917967 2007 Myeloid leukemias express a broad spectrum of VEGF receptors including neuropilin-1 (NRP-1) and NRP-2.
17891484 2008 Association of polymorphisms of angiogenesis genes with breast cancer.
17699524 2007 Polysialylated neuropilin-2 is expressed on the surface of human dendritic cells and modulates dendritic cell-T lymphocyte interactions.
17427189 2007 Association of the neuropilin-2 (NRP2) gene polymorphisms with autism in Chinese Han population.
17088944 Immunolocalization and expression of vascular endothelial growth factor receptors (VEGFRs) and neuropilins (NRPs) on keratinocytes in human epidermis.
16816121 2006 Functional interaction of VEGF-C and VEGF-D with neuropilin receptors.
16621967 2006 Neuropilin-2 interacts with VEGFR-2 and VEGFR-3 and promotes human endothelial cell survival and migration.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15613413 2005 Cellular expression and hormonal regulation of neuropilin-1 and -2 messenger ribonucleic Acid in the human and rhesus macaque endometrium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760080 2004 Aberrant expression of neuropilin-1 and -2 in human pancreatic cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12845630 2003 Expression of VEGF, semaphorin SEMA3F, and their common receptors neuropilins NP1 and NP2 in preinvasive bronchial lesions, lung tumours, and cell lines.
12730958 2003 Human malignant glioma cells express semaphorins and their receptors, neuropilins and plexins.
12659673 Semaphorin SEMA3F and VEGF have opposing effects on cell attachment and spreading.
12632379 2003 VEGF receptors are differentially expressed by neuroblastoma cells in culture.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12412174 2002 Neuropilin 1 and neuropilin 2 co-expression is significantly correlated with increased vascularity and poor prognosis in nonsmall cell lung carcinoma.
12210066 2002 Neuropilin-2 is a novel marker expressed in pancreatic islet cells and endocrine pancreatic tumours.
11815985 2002 Selective upregulation of vascular endothelial growth factor receptors neuropilin-1 and -2 in human neuroblastoma.
11756651 2002 Selective induction of neuropilin-1 by vascular endothelial growth factor (VEGF): a mechanism contributing to VEGF-induced angiogenesis.
11677062 2001 Differential expression of neuropilin-1 and neuropilin-2 in arteries and veins.
11394892 2001 Neuroendocrine cells along the digestive tract express neuropilin-2.
11278319 2001 Vascular endothelial growth factor receptor-1 and neuropilin-2 form complexes.
11112349 2000 Genomic organization of human neuropilin-1 and neuropilin-2 genes: identification and distribution of splice variants and soluble isoforms.
10891538 2000 Neuropilin-2 expression affects the increased vascularization and is a prognostic factor in osteosarcoma.
10748121 2000 Neuropilin-2 is a receptor for the vascular endothelial growth factor (VEGF) forms VEGF-145 and VEGF-165 [corrected].
10520995 1999 Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.
10329017 1999 Human neuropilin-1 and neuropilin-2 map to 10p12 and 2q34, respectively.
10196546 1998 Semaphorins A and E act as antagonists of neuropilin-1 and agonists of neuropilin-2 receptors.
9883722 1998 Semaphorin-neuropilin interactions underlying sympathetic axon responses to class III semaphorins.
9872925 1999 Vascular endothelial growth factor (VEGF) and its receptors.
9856463 1998 Neuropilin-2 is a receptor for semaphorin IV: insight into the structural basis of receptor function and specificity.
9529250 1998 Neuropilin-1 is expressed by endothelial and tumor cells as an isoform-specific receptor for vascular endothelial growth factor.
9331348 1997 Neuropilin-2, a novel member of the neuropilin family, is a high affinity receptor for the semaphorins Sema E and Sema IV but not Sema III.