Property Summary

NCBI Gene PubMed Count 12
PubMed Score 19.41
PubTator Score 6.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Seminoma 15 3.261 1.6

Expression

Gene RIF (5)

PMID Text
23092226 these findings implicate that the inner nuclear membrane protein Nurim plays an important role in the suppression of apoptosis
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
15542857 nurim is a polytopic protein tightly associated with the inner nuclear membrane

AA Sequence

MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL      1 - 70
LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL     71 - 140
CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV    141 - 210
PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE                      211 - 262
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23092226 2012 The integral nuclear membrane protein nurim plays a role in the suppression of apoptosis.
19946888 2010 Defining the membrane proteome of NK cells.
17517639 2007 Early sorting of inner nuclear membrane proteins is conserved.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15542857 2005 Analysis of the localization and topology of nurim, a polytopic protein tightly associated with the inner nuclear membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11766875 2001 Inner nuclear membrane proteins: functions and targeting.
10402458 1999 A visual screen of a GFP-fusion library identifies a new type of nuclear envelope membrane protein.