Property Summary

NCBI Gene PubMed Count 24
PubMed Score 209.37
PubTator Score 69.93

Knowledge Summary

Patent (9,897)

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 3.9e-05
psoriasis 1.300 1.4e-03
osteosarcoma 1.093 3.7e-05
ovarian cancer 1.400 6.4e-12

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
26769970 the genes, and up-regulated 64% in undifferentiated hES cells. In addition, GCNF also showed a regulatory gene pattern that is different from RA treatment during hES cell differentiation
23532770 Our results show that cellular levels of NR6A1 are correlated with disease progression in prostate cancer.
23495137 Findings show a role for Gcnf as a regulator of iPS cell pluripotency gene expression. It also demonstrates that reactivation of the Gcnf gene may serve as a marker to distinguish completely reprogrammed iPS cells from incompletely pluripotent cells.
21056546 These experiments confirmed that NR6A1 works as a regulator for hypocretin transcription.
20583170 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15456763 down-regulation of CREMtau-mediated gene expression by GCNF
12080054 characterization of a novel nuclear protein, referred to as RAP80, that interacts with the retinoid-related testis-associated receptor
11969338 RTR mRNA was expressed in the human placental choriocarcinoma cell lines BeWo, JAR, and JEG-3.

AA Sequence

MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTISVSDDRAEQRTCLICGDRATGL      1 - 70
HYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRN     71 - 140
KSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRSVELNGFMAF    141 - 210
REQYMGMSVPPHYQYIPHLFSYSGHSPLLPQQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYAVTQ    211 - 280
AELFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAK    281 - 350
YSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWY    351 - 420
ICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGKE              421 - 480
//

Text Mined References (26)

PMID Year Title
26769970 2016 Germ Cell Nuclear Factor (GCNF) Represses Oct4 Expression and Globally Modulates Gene Expression in Human Embryonic Stem (hES) Cells.
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
23532770 2013 Expression screening of cancer/testis genes in prostate cancer identifies NR6A1 as a novel marker of disease progression and aggressiveness.
23495137 2013 Epigenetic reprogramming of the germ cell nuclear factor gene is required for proper differentiation of induced pluripotent cells.
21056546 2010 Transcriptional regulation of the hypocretin/orexin gene by NR6A1.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456763 2004 Germ cell nuclear factor relieves cAMP-response element modulator tau-mediated activation of the testis-specific promoter of human mitochondrial glycerol-3-phosphate dehydrogenase.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12606326 2003 Analysis of germ cell nuclear factor transcripts and protein expression during spermatogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381721 2002 The embryonic function of germ cell nuclear factor is dependent on the DNA binding domain.
12080054 2002 RAP80, a novel nuclear protein that interacts with the retinoid-related testis-associated receptor.
11969338 2002 Characterization of the expression of the retinoid-related, testis-associated receptor (RTR) in trophoblasts.
11387038 2001 Genomic structure of the gene for mouse germ-cell nuclear factor (GCNF). II. Comparison with the genomic structure of the human GCNF gene.
10940306 2000 Characterization of the repressor function of the nuclear orphan receptor retinoid receptor-related testis-associated receptor/germ cell nuclear factor.
10524192 1999 DNA binding, protein interaction and differential expression of the human germ cell nuclear factor.
9858592 1999 Characterization of the DNA-binding and dimerization properties of the nuclear orphan receptor germ cell nuclear factor.
9846950 Germ cell nuclear factor: an orphan receptor with unexpected properties.
9537518 1998 Cloning, expression analysis and chromosomal localization of the human nuclear receptor gene GCNF.
9493564 1998 Cloning of the human NCNF gene.
9177477 1997 cDNA cloning of two closely related forms of human germ cell nuclear factor (GCNF).
9134503 1997 Cloning of the human orphan receptor germ cell nuclear factor/retinoid receptor-related testis-associated receptor and its differential regulation during embryonal carcinoma cell differentiation.
9099702 1997 Characterization of the response element and DNA binding properties of the nuclear orphan receptor germ cell nuclear factor/retinoid receptor-related testis-associated receptor.
8982251 1996 Characterization of the human germ cell nuclear factor gene.