1. Home
  2. Targets
  3. Nuclear hormone receptor
  4. Coup-tf-like receptors
  5. COUP transcription factor 1

Tbio COUP transcription factor 1

Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. Binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif. Represses transcriptional activity of LHCG.

The protein encoded by this gene is a nuclear hormone receptor and transcriptional regulator. The encoded protein acts as a homodimer and binds to 5'-AGGTCA-3' repeats. Defects in this gene are a cause of Bosch-Boonstra optic atrophy syndrome (BBOAS). [provided by RefSeq, Apr 2014]

 Comments

Property Summary

NCBI Gene PubMed Count 39
PubMed Score 96.69
PubTator Score 94.77

Knowledge Summary

Patent (6,217)

TINX Plot

  Disease (4)

Disease Target Count
Mammary Neoplasms 410
Ovarian Cysts 34
Disease Target Count Z-score Confidence
Optic atrophy 43 3.169 1.6

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma 2.200 8.9e-03
malignant mesothelioma -4.000 3.0e-09
osteosarcoma -2.489 1.2e-02
cystic fibrosis -1.226 9.1e-06
astrocytoma 1.500 2.7e-02
Atopic dermatitis -1.200 1.1e-03
adrenocortical carcinoma -2.341 3.0e-06
non-small cell lung cancer -1.641 2.3e-23
intraductal papillary-mucinous adenoma (... -2.500 2.1e-03
intraductal papillary-mucinous carcinoma... -2.700 2.6e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.3e-02
lung cancer -2.200 9.2e-06
breast carcinoma -1.700 3.1e-05
group 4 medulloblastoma -1.500 2.3e-02
invasive ductal carcinoma -1.096 4.5e-02
lung carcinoma -1.300 1.9e-17
spina bifida 1.461 5.0e-02
ovarian cancer -4.500 5.8e-09
pituitary cancer -1.400 1.1e-04
head and neck cancer -1.300 3.3e-02

Synonym

Accession P10589 COUP-TF1
Symbols EAR3
BBOAS
EAR-3
NR2F2
SVP44
BBSOAS
ERBAL3
TFCOUP1
COUP-TFI
TCFCOUP1

Gene

NR2F1

PANTHER Protein Class (2)

PDB

2EBL  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (2)

Steve Finkbeiner 41 Neuron specific phenotypes being screened
Jun Qin 39 Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 UniProt Keyword (15)

See all...

 GO Function (7)

 GO Component (2)

 GO Process (5)

 Compartment GO Term (19)

See all...

 MGI Phenotype (8)

 HCA RNA Cell Line (54)

See all...

Pathway (7)

Protein-protein Interaction (1)

MED1  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (26)

PMID Text
25787832 COUP-TFII is expressed in a diverse subset of GABAergic interneurons predominantly innervating small dendritic shafts originating from both interneurons and pyramidal cells.
24906407 our mechanistic in vitro assays and in vivo results suggest that a reduction in chemokine CXCL12 expression, with an enhancement of CXCR4 expression, provoked by COUP-TFI, could be associated with an increase in the invasive potential of breast cancer
24462372 NR2F1 has an important role in the development of the visual system and that haploinsuffiency can lead to optic atrophy with intellectual impairment.
23975195 COUP-TFI and related NRs such as the COUPTFs and PNR can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates COUP-TFII-mediated repression of the RARb2 gene.
23975195 Interaction of NSD1 with the NR2E/F subfamily including COUP-TFI, COUP-TFII, EAR2 and TLX requires an F/YSXXLXXL/Y motif. Interactions of NSD1 with liganded NRs require an overlapping LXXLL motif.
22357705 a novel mechanism of MTP repression that involves binding of NR2F1 to the DR1 element and recruitment of corepressors
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20111703 provide detailed experimental validation of each step and, as a proof of principle, utilize the methodology to identify novel direct targets of the orphan nuclear receptor NR2F1 (COUP-TFI)
20007910 Transcriptional and posttranscriptional mechanisms involving NR2F1 and IRE1beta ensure low microsomal triglyceride transfer protein expression in undifferentiated intestinal cells and avoid apolipoprotein B lipoprotein biosynthesis.
19578876 Observational study of gene-disease association. (HuGE Navigator)
19526345 study identifies two unique corticotroph tumor populations which differ in their expression of COUP-TFI, the presence of which occurs more frequently in macroadenomas.
19460752 Knockdown of nuclear receptor subfamily 2, group F, member 1 (NR2F1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19112178 A chicken ovalbumin upstream promoter transcription factor I (COUP-TFI) complex represses expression of the gene encoding tumor necrosis factor alpha-induced protein 8 (TNFAIP8).
18199540 Regulation of vascular endothelial growth factor D by hepatocyte nuclear factor-4 alpha and chicken ovalbumin upstream promoter transcription factors 1 and 2.
17674191 COUP-TFI selectively regulates the expression of endogenous E2-target genes and consequently modifies ER alpha positive mammary cells response to E2.
17009409 findings show that enhancer II of HBV genotype A is also repressed by COUP-TF1; in contrast, two different enhancer II constructs of HBV genotype D were activated by COUP-TF1
15157742 COUP-TF may be involved in repression of the human MGP gene promoter at the myoblast stage
12972613 Transcription of the LHR gene is repressed by EAR3.
12551987 regulates transcription of hepatitis B virus
12093745 Formation of an hER alpha-COUP-TFI complex enhances hER alpha AF-1 through Ser118 phosphorylation by MAPK.
11934895 Regulation of retinoic acid-induced inhibition of AP-1 activity by orphan receptor chicken ovalbumin upstream promoter-transcription factor.
11811951 Inhibit aldehyde dehydrogenase 2 gene expression
10644726 Through amino acids 49-148, COUP-TF physically interacts with amino acids 48-72 of HIV-1 Tat, allowing COUP-TF to cooperate with Tat during transactivation of the HIV-1 LTR promoter
9388268 Through amino acids 49-148, COUP-TF physically interacts with amino acids 48-72 of HIV-1 Tat, allowing COUP-TF to cooperate with Tat during transactivation of the HIV-1 LTR promoter
8798567 Through amino acids 49-148, COUP-TF physically interacts with amino acids 48-72 of HIV-1 Tat, allowing COUP-TF to cooperate with Tat during transactivation of the HIV-1 LTR promoter
2739739 Through amino acids 49-148, COUP-TF physically interacts with amino acids 48-72 of HIV-1 Tat, allowing COUP-TF to cooperate with Tat during transactivation of the HIV-1 LTR promoter

AA Sequence 

MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDK      1 - 70
GQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQY     71 - 140
CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQP    141 - 210
NNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAA    211 - 280
GLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQC    281 - 350
ALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI    351 - 420
QCS                                                                       421 - 423
//

Text Mined References (40)

PMID Year Title
25787832 2015 Molecular and Electrophysiological Characterization of GABAergic Interneurons Expressing the Transcription Factor COUP-TFII in the Adult Human Temporal Cortex.
24906407 2014 COUP-TFI modifies CXCL12 and CXCR4 expression by activating EGF signaling and stimulates breast cancer cell migration.
24462372 2014 NR2F1 mutations cause optic atrophy with intellectual disability.
23975195 2013 A signature motif mediating selective interactions of BCL11A with the NR2E/F subfamily of orphan nuclear receptors.
22357705 2012 NR2F1 disrupts synergistic activation of the MTTP gene transcription by HNF-4? and HNF-1?.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20111703 2010 Genome-wide analysis of binding sites and direct target genes of the orphan nuclear receptor NR2F1/COUP-TFI.
20007910 2010 NR2F1 and IRE1beta suppress microsomal triglyceride transfer protein expression and lipoprotein assembly in undifferentiated intestinal epithelial cells.
19578876 2009 The ERAP2 gene is associated with preeclampsia in Australian and Norwegian populations.
19526345 2010 Immunohistochemistry of COUP-TFI: an adjuvant diagnostic tool for the identification of corticotroph microadenomas.
19112178 2009 A chicken ovalbumin upstream promoter transcription factor I (COUP-TFI) complex represses expression of the gene encoding tumor necrosis factor alpha-induced protein 8 (TNFAIP8).
18199540 2008 Regulation of vascular endothelial growth factor D by orphan receptors hepatocyte nuclear factor-4 alpha and chicken ovalbumin upstream promoter transcription factors 1 and 2.
17674191 2008 COUP-TFI modulates estrogen signaling and influences proliferation, survival and migration of breast cancer cells.
17009409 2006 Genotype-dependent activation or repression of HBV enhancer II by transcription factor COUP-TF1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15157742 2004 Chicken ovalbumin upstream promoter-transcription factor I represses the transcriptional activity of the human muscle glycogen phosphorylase promoter in C2C12 cells.
12972613 2003 Repression of the luteinizing hormone receptor gene promoter by cross talk among EAR3/COUP-TFI, Sp1/Sp3, and TFIIB.
12551987 2003 Distinct modes of regulation of transcription of hepatitis B virus by the nuclear receptors HNF4alpha and COUP-TF1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130562 2002 The glucocorticoid receptor represses the positive autoregulation of the trout estrogen receptor gene by preventing the enhancer effect of a C/EBPbeta-like protein.
12093745 2002 Formation of an hER alpha-COUP-TFI complex enhances hER alpha AF-1 through Ser118 phosphorylation by MAPK.
11811951 2002 Transcriptional control of the human aldehyde dehydrogenase 2 promoter by hepatocyte nuclear factor 4: inhibition by cyclic AMP and COUP transcription factors.
11682620 2001 EAR2 and EAR3/COUP-TFI regulate transcription of the rat LH receptor.
11043578 2000 The LIM/homeodomain protein islet-1 modulates estrogen receptor functions.
10744719 2000 Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors.
10656770 2000 Subcellular trafficking of the nuclear receptor COUP-TF in the early embryonic cell cycle.
10652338 2000 Transcription activation by the orphan nuclear receptor, chicken ovalbumin upstream promoter-transcription factor I (COUP-TFI). Definition of the domain involved in the glucocorticoid response of the phosphoenolpyruvate carboxykinase gene.
10644740 2000 Nuclear orphan receptors regulate transcription of the gene for the human luteinizing hormone receptor.
10644726 2000 The nuclear receptor chicken ovalbumin upstream promoter transcription factor interacts with HIV-1 Tat and stimulates viral replication in human microglial cells.
10620335 2000 The aryl hydrocarbon receptor interacts with estrogen receptor alpha and orphan receptors COUP-TFI and ERRalpha1.
10207062 1999 Alien, a highly conserved protein with characteristics of a corepressor for members of the nuclear hormone receptor superfamily.
9388268 1997 COUP-TF and Sp1 interact and cooperate in the transcriptional activation of the human immunodeficiency virus type 1 long terminal repeat in human microglial cells.
8798567 1996 Chicken ovalbumin upstream promoter transcription factor, a transcriptional activator of HIV-1 gene expression in human brain cells.
8551580 1996 The major transcriptional transactivation domain of simian virus 40 large T antigen associates nonconcurrently with multiple components of the transcriptional preinitiation complex.
8530078 1995 Isolation, characterization, and chromosomal localization of mouse and human COUP-TF I and II genes.
2905047 1988 Identification of two novel members of erbA superfamily by molecular cloning: the gene products of the two are highly related to each other.
2739739 1989 COUP transcription factor is a member of the steroid receptor superfamily.
1517211 1992 Members of the steroid hormone receptor superfamily interact with TFIIB (S300-II).
1331778 1992 Heterodimerization among thyroid hormone receptor, retinoic acid receptor, retinoid X receptor, chicken ovalbumin upstream promoter transcription factor, and an endogenous liver protein.
1311101 1992 Retinoid X receptor-COUP-TF interactions modulate retinoic acid signaling.