Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.829 4.9e-07
medulloblastoma, large-cell 1.100 3.0e-04
Duchenne muscular dystrophy 1.140 1.5e-04
Becker muscular dystrophy 1.484 3.3e-03
acute quadriplegic myopathy -1.046 2.0e-03
colon cancer -3.900 9.8e-13
pituitary cancer 1.100 4.3e-02
dermatomyositis -1.100 2.2e-04

AA Sequence

MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIIIFKKQRKAQNF      1 - 70
TSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSISVSIFSLVFTAVERYQLIVN     71 - 140
PRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPFRNLSLPTDLYTHQVACVENWPSKKDRLLFT    141 - 210
TSLFLLQYFVPLGFILICYLKIVICLRRRNAKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISS    211 - 280
MSSLTGIMRC                                                                281 - 290
//

Text Mined References (4)

PMID Year Title
11027673 2000 Neuropeptide Y receptor gene y6: multiple deaths or resurrections?
9013614 1997 Molecular genetic analysis of a human neuropeptide Y receptor. The human homolog of the murine "Y5" receptor may be a pseudogene.
8910373 1996 Molecular characterization of a second mouse pancreatic polypeptide receptor and its inactivated human homologue.
8910290 1996 Inactivation of a novel neuropeptide Y/peptide YY receptor gene in primate species.