Property Summary

NCBI Gene PubMed Count 72
PubMed Score 39.06
PubTator Score 56.87

Knowledge Summary

Patent (4,471)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
ependymoma -1.600 2.8e-02
oligodendroglioma -1.500 2.1e-02
glioblastoma -1.600 3.7e-04
medulloblastoma, large-cell -1.500 2.9e-02
primitive neuroectodermal tumor -1.400 1.6e-02
pilocytic astrocytoma -1.100 6.6e-03
non primary Sjogren syndrome sicca -1.100 2.2e-02
Breast cancer -4.600 1.4e-97
breast carcinoma -1.200 1.6e-06

Protein-protein Interaction (159)

MLP Assay (31)

AID Type Active / Inconclusive / Inactive Description
793 screening 1385 / 0 / 138724 Primary cell based high-throughput screening assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2)
1255 screening 332 / 0 / 863 Counterscreen assay for antagonists of neuropeptide Y receptor Y1 (NPY-Y1): Cell-based high throughput assay to measure NPY-Y2 antagonism
1257 screening 228 / 0 / 479 Cell-based high throughput confirmation assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2)
1272 confirmatory 72 / 0 / 47 Dose response cell-based screening assay for antagonists of neuropeptide Y receptor Y2 (NPY-Y2)
1278 confirmatory 8 / 0 / 55 Dose response counterscreen assay for neuropeptide Y receptor Y1 (NPY-Y1): Cell-based high throughput assay to measure NPY-Y2 antagonism
1359 screening 971 / 0 / 217146 Primary cell-based high-throughput screening assay for potentiators or agonists of NPY-Y2
1539 screening 92 / 0 / 361 Confirmation cell-based high-throughput screening assay for potentiators or agonists of NPY-Y2
1649 screening 65 / 0 / 216 Fluorescence counterscreen assay for potentiators or agonists of NPY-Y1: Cell-based high-throughput screening assay to identify potentiators or agonists of NPY-Y2.
1698 screening 187 / 0 / 94 Fluorescence counterscreen assay for potentiators or agonists of NPY-Y1: cell-based high-throughput screening assay to identify agonists of NPY-Y2.
1710 screening 253 / 0 / 200 Fluorescence-based counterscreen assay for potentiators of NPY-Y2: cell-based high-throughput screening assay to identify agonists of NPY-Y2.
More...

Gene RIF (65)

PMID Text
25924821 The C-terminal alpha-helix of Neuropeptide Y, which is formed in a membrane environment in the absence of the receptor, is unwound starting at T(32) to provide optimal contacts in a binding pocket within the transmembrane bundle of the NPY-Y2 receptor.
25871004 polymorphisms in the NPY2R gene may be useful in identifying women at risk for osteoporosis.
25157429 Data show that the Y2-receptor high expression G allele is associated with a less efficient mode of action cascading where different task goals are activated in parallel.
24709141 The results of this study provide evidence that the functionally relevant single nucleotide polymorphism (SNP) in the NPY2R promoter gene affect circumscribed processes of early sensory processing
24623336 The molecular mobility of the human neuropeptide Y receptor type 2 reconstituted into dimyristoylphosphatidylcholine (DMPC) membranes was investigated by means of solid-state NMR spectroscopy.
24365162 This study reviews neuropeptide Y2 receptor modulators (mainly non-peptidic antagonists) and their structure-activity relationships.
24121255 Data indicate modest association of the age at onset (AO) with two neuropeptide Y (NPY) promoter variations and a highly significant association with NPY receptor NPY2R promoter single nucleotide polymorphism (SNP rs2234759).
23149563 this study concludes that common genetic variation in the proximal NPY2R promoter influences transcription factor binding so as to alter gene expression in neuroendocrine cells, and consequently cardiometabolic traits in humans.
23020974 we determined the role of the C-terminus in the anterograde transport of the human neuropeptide Y receptor (hYR) type 2
22732667 Surface masking of the Y2 receptor could to a degree reflect restricted access of the large (34-36-residue) physiological agonists.
22629465 NPY2R expression in neonatal saliva is predictive of an immature feeding pattern.
22487268 The influence of beta-arrestin adaptors and endocytosis mechanisms on plasma membrane diffusion and particle brightness of GFP-tagged neuropeptide Y (NPY) receptors, was investigated.
21999704 protocol for the preparation of fully active Y2 G protein-coupled receptor
21818152 Four genetic loci were strongly and independently associated with obesity, NPY2R, NPFFR2, MC4R, and FTO.
21745157 Results report on the functional reconstitution of the hY(2)R and the hY(4)R in Sf9 insect cells using the baculovirus system.
21696823 Data present a site-directed mutagenesis study of four amino acid positions in the human Y2 receptor.
21352822 Increased expression of NPY-Y2 receptors in symptomatic carotid plaque vascular smooth muscle cells.
21295110 neuropeptide Y1 and Y2 receptors were expressed in 33 percent of testicular tumors and Y1 on intratumoral blood vessels in 50 percent of testicular tumors
20959467 Ligand-induced internalization and recycling of the human neuropeptide Y2 receptor is regulated by its carboxyl-terminal tail
20811389 These results suggest that the rs4425326 polymorphism in NPY2R may be a possible genetic factor for nicotine dependence in the Japanese elderly population.
20811389 Observational study of gene-disease association. (HuGE Navigator)
20676138 Data show that both NPY and Y2Rs are commonly expressed in neuroblastoma cell lines and tissues.
20642810 Several LEP, and NPY2R and PYY SNPs were associated with obesity-related phenotypes in young adults, particularly among African-Americans.
20642810 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20543711 NPY receptor Y2 polymorphism is independently associated with left ventricular mass index and interacts with plasma levels of NPY in explaining the variability of left ventricular hypertrophy in ESRD.
20471432 results suggest that the receptor-ligand interactions have changed during evolution after Y1 and Y2 arose from a common ancestral receptor
20468064 Observational study of gene-disease association. (HuGE Navigator)
20421142 Described is the membrane reconstitution of the refolded human neuropeptide Y receptor Type 2 (Y2 receptor) into phospholipid membranes.
20359722 effect on metabolic parameters of single nucleotide polymorphisms in the 5'-flanking region of NPY2R gene
20359722 Observational study of gene-disease association. (HuGE Navigator)
19957593 Mutation rate of the rs1047214 polymorphism in NPY2R gene in Chinese adolescents was higher than in foreign populations. Polymorphism seemed to be associated with obesity in males but did not in phenotypes of metabolic syndrome.
19957593 Observational study of gene-disease association. (HuGE Navigator)
19953226 Report binding and pharmacology of neuropeptide Y Y2 receptor antagonist JNJ-31020028.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19759915 Observational study of gene-disease association. (HuGE Navigator)
19593212 Observational study of gene-disease association. (HuGE Navigator)
19481128 Results suggest that rabbit and human Y1, Y2 and Y5 receptor subtypes are well conserved, whereas Y4 receptors are less well conserved.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18828811 Single nucleotide polymorphisms in NPY2R provide significant evidence of association with alcohol dependence, alcohol withdrawal symptoms, comorbid alcohol and cocaine dependence, and cocaine dependence.
18828811 Observational study of gene-disease association. (HuGE Navigator)
18700141 the N-terminal extracellular segment of the neuropeptide Y Y2 receptor thus apparently has a large role in anchoring and compartmentalization of the receptor
18622237 Y2R gene variants are involved in blood pressure regulation in obese children and adolescents
18622237 Observational study of gene-disease association. (HuGE Navigator)
18569526 The rabbit kidney and the human CHO cell-expressed Y2 dimers are converted by agonists to monomers in vitro at a similar rate in the presence of divalent cations.
17992642 Observational study of gene-disease association. (HuGE Navigator)
17992642 In case-control analyses and a family-based association study an association with obesity for seven common variants was not detected; additional gender-stratified analyses were also nonsignificant.
17948870 Observational study of gene-disease association. (HuGE Navigator)
17325259 Observational study of gene-disease association. (HuGE Navigator)
17325259 NPY2R should be considered a candidate gene for type 2 diabetes in men.
17235527 Observational study of gene-disease association. (HuGE Navigator)
17235527 A rare variant of the NPY2R gene showed evidence of co-segregation with obesity.
17019604 Observational study of gene-disease association. (HuGE Navigator)
17019604 Common variants in the 5' region of NPY2R are associated with obesity in Danish white subjects.
16891622 Neuropeptide-Y induced endothelial cell migration was mimicked by agonists and fully blocked by antagonists for any specific NPY receptor (NPY2R).
16331299 Observational study of gene-disease association. (HuGE Navigator)
15855352 Y2R pathway may influence body weight through a sex-specific mechanism.
15623622 High expression of neuropeptide Y receptor Y2 is associated with tumors of the human adrenal gland and extra-adrenal paraganglia
15331560 Observational study of gene-disease association. (HuGE Navigator)
15331560 mutations in PYY and Y2R are not commonly found in humans with severe early-onset obesity.
12813010 tonic activation of submucosal Y(2) receptors could indirectly reduce mucosal ion transport in the colon, while direct activation of Y(2) receptors on longitudinal muscle results in contraction
12084524 human NPY Y1 and NPY Y2 receptors were detected in cerebral, meningeal, and coronary arteries using reverse transcriptase-polymerase chain reaction (RT-PCR); in addition, the trigeminal and superior cervical ganglia were positive for both receptors
11906964 Peptide YY and neuropeptide Y exert their effects through the NPY2 receptors, which are located on intrinsic neurons as well as epithelia in colon mucosa.

AA Sequence

MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSL      1 - 70
VIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTIT     71 - 140
LTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGE    141 - 210
EKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVS    211 - 280
WLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIH    281 - 350
SEVSVTFKAKKNLEVRKNSGPNDSFTEATNV                                           351 - 381
//

Text Mined References (73)

PMID Year Title
25924821 2015 Unwinding of the C-Terminal Residues of Neuropeptide Y is critical for Y? Receptor Binding and Activation.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25157429 2014 On the relevance of the NPY2-receptor variation for modes of action cascading processes.
24709141 2014 NPY2-receptor variation modulates iconic memory processes.
24623336 2014 The G-protein-coupled neuropeptide Y receptor type 2 is highly dynamic in lipid membranes as revealed by solid-state NMR spectroscopy.
24365162 2014 Ligands of the neuropeptide Y Y2 receptor.
24121255 2014 Association of age at onset in Huntington disease with functional promoter variations in NPY and NPY2R.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23149563 2013 Heredity and cardiometabolic risk: naturally occurring polymorphisms in the human neuropeptide Y(2) receptor promoter disrupt multiple transcriptional response motifs.
23020974 2012 The anterograde transport of the human neuropeptide Y2 receptor is regulated by a subtype specific mechanism mediated by the C-terminus.
22732667 2012 Surface masking shapes the traffic of the neuropeptide Y Y2 receptor.
22629465 2012 Neuropeptide Y2 receptor (NPY2R) expression in saliva predicts feeding immaturity in the premature neonate.
22487268 2012 Fluorescence correlation spectroscopy, combined with bimolecular fluorescence complementation, reveals the effects of ?-arrestin complexes and endocytic targeting on the membrane mobility of neuropeptide Y receptors.
21999704 2011 Assessment of a fully active class A G protein-coupled receptor isolated from in vitro folding.
21818152 2011 Polymorphisms in the NPY2R gene show significant associations with BMI that are additive to FTO, MC4R, and NPFFR2 gene effects.
21745157 2011 Functional reconstitution of human neuropeptide Y (NPY) Y(2) and Y(4) receptors in Sf9 insect cells.
21696823 2011 Identification of positions in the human neuropeptide Y/peptide YY receptor Y2 that contribute to pharmacological differences between receptor subtypes.
21352822 2011 Neuropeptide Y receptors in carotid plaques of symptomatic and asymptomatic patients: effect of inflammatory cytokines.
21295110 2011 High expression of NPY receptors in the human testis.
20959467 2010 Ligand-induced internalization and recycling of the human neuropeptide Y2 receptor is regulated by its carboxyl-terminal tail.
20811389 2010 Association between neuropeptide Y receptor 2 polymorphism and the smoking behavior of elderly Japanese.
20676138 2010 Neuropeptide Y and its Y2 receptor: potential targets in neuroblastoma therapy.
20642810 2010 Candidate molecular pathway genes related to appetite regulatory neural network, adipocyte homeostasis and obesity: results from the CARDIA Study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20543711 2010 Neuropeptide Y receptor Y2 gene polymorphism interacts with plasma neuropeptide Y levels in predicting left ventricular hypertrophy in dialysis patients.
20471432 2010 Mutagenesis of human neuropeptide Y/peptide YY receptor Y2 reveals additional differences to Y1 in interactions with highly conserved ligand positions.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20421142 2010 A reconstitution protocol for the in vitro folded human G protein-coupled Y2 receptor into lipid environment.
20359722 2010 Variation in the 5'-flanking region of the neuropeptide Y2 receptor gene and metabolic parameters.
19957593 2009 [Association between obesity and the polymorphism of neuropeptide Y2 receptor gene in children and adolescents].
19953226 2010 In vitro and in vivo characterization of JNJ-31020028 (N-(4-{4-[2-(diethylamino)-2-oxo-1-phenylethyl]piperazin-1-yl}-3-fluorophenyl)-2-pyridin-3-ylbenzamide), a selective brain penetrant small molecule antagonist of the neuropeptide Y Y(2) receptor.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19759915 2009 Variants in neuropeptide Y receptor 1 and 5 are associated with nutrient-specific food intake and are under recent selection in Europeans.
19593212 2009 Novel genetic variants contributing to left ventricular hypertrophy: the HyperGEN study.
19481128 2009 Cloning and characterization of rabbit neuropeptide Y receptor subtypes.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18828811 2008 Neuropeptide Y receptor genes are associated with alcohol dependence, alcohol withdrawal phenotypes, and cocaine dependence.
18700141 2008 Importance of a N-terminal aspartate in the internalization of the neuropeptide Y Y2 receptor.
18622237 2008 Y2 receptor gene variants reduce the risk of hypertension in obese children and adolescents.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18569526 2008 The neuropeptide Y (NPY) Y2 receptors are largely dimeric in the kidney, but monomeric in the forebrain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17992642 2007 No association of sequence variants in the neuropeptide Y2 receptor (NPY2R) gene with early onset obesity in Germans.
17948870 2008 Chromosome 4q31-34 panic disorder risk locus: association of neuropeptide Y Y5 receptor variants.
17325259 2007 Association studies of BMI and type 2 diabetes in the neuropeptide Y pathway: a possible role for NPY2R as a candidate gene for type 2 diabetes in men.
17235527 2007 Single nucleotide polymorphisms in the neuropeptide Y2 receptor (NPY2R) gene and association with severe obesity in French white subjects.
17019604 2006 Variants in the 5' region of the neuropeptide Y receptor Y2 gene (NPY2R) are associated with obesity in 5,971 white subjects.
16891622 2006 Neuropeptide Y induces migration, proliferation, and tube formation of endothelial cells bimodally via Y1, Y2, and Y5 receptors.
16331299 2006 Common neuropeptide Y2 receptor gene variant is protective against obesity among Swedish men.
15855352 2005 Variations in peptide YY and Y2 receptor genes are associated with severe obesity in Pima Indian men.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15623622 2004 High expression of neuropeptide y receptors in tumors of the human adrenal gland and extra-adrenal paraganglia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331560 2004 Studies of the peptide YY and neuropeptide Y2 receptor genes in relation to human obesity and obesity-related traits.
12813010 2003 Functional consequences of neuropeptide Y Y 2 receptor knockout and Y2 antagonism in mouse and human colonic tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084524 2002 Neuropeptide Y Y1 and neuropeptide Y Y2 receptors in human cardiovascular tissues.
12007534 2002 Neuropeptide Y receptors as targets for anti-obesity drug development: perspective and current status.
11906964 2002 Neuropeptide Y, Y1, Y2 and Y4 receptors mediate Y agonist responses in isolated human colon mucosa.
11408607 2001 The peptide YY-preferring receptor mediating inhibition of small intestinal secretion is a peripheral Y(2) receptor: pharmacological evidence and molecular cloning.
9692752 1998 Regional distribution of neuropeptide Y Y2 receptor messenger RNA in the human post mortem brain.
9651375 1998 GTPase activating specificity of RGS12 and binding specificity of an alternatively spliced PDZ (PSD-95/Dlg/ZO-1) domain.
9001438 1995 Neuropeptide Y receptor subtypes.
8975716 1996 Characterization of the human type 2 neuropeptide Y receptor gene (NPY2R) and localization to the chromosome 4q region containing the type 1 neuropeptide Y receptor gene.
8643460 1996 Cloning and functional expression of cDNAs encoding human and rat pancreatic polypeptide receptors.
8632753 1996 Expression cloning of a human brain neuropeptide Y Y2 receptor.
8132547 1994 A pertussis toxin-insensitive calcium influx mediated by neuropeptide Y2 receptors in a human neuroblastoma cell line.
7592910 1995 Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype.
7559383 1995 Cloning and functional expression of a cDNA encoding a human type 2 neuropeptide Y receptor.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
1321422 1992 Cloned human neuropeptide Y receptor couples to two different second messenger systems.