Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.00
PubTator Score 7.15

Knowledge Summary


No data available


  Disease (3)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 140 0.0 0.0
Disease Models, Animal 148 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2799 1.8e-16
psoriasis 6514 3.7e-09
lung cancer 4607 4.5e-04
atypical teratoid/rhabdoid tumor 349 9.1e-04
colon cancer 1428 3.8e-03
osteosarcoma 7766 1.3e-02
Disease Target Count Z-score Confidence
Fatal familial insomnia 10 3.366 1.7


  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 9.1e-04
colon cancer 1.100 3.8e-03
lung cancer 2.100 4.5e-04
non-small cell lung cancer 1.578 1.8e-16
osteosarcoma -1.099 1.3e-02
psoriasis 1.100 3.7e-09


Accession O75607 Q9UNY6
Symbols PORMIN


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP                                    141 - 178

Text Mined References (28)

PMID Year Title