Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.00
PubTator Score 7.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2890 1.8e-16
psoriasis 6694 3.7e-09
lung cancer 4740 4.5e-04
atypical teratoid/rhabdoid tumor 357 9.1e-04
colon cancer 1478 3.8e-03
osteosarcoma 7950 1.3e-02
Disease Target Count Z-score Confidence
Fatal familial insomnia 10 3.366 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 9.1e-04
colon cancer 1.100 3.8e-03
lung cancer 2.100 4.5e-04
non-small cell lung cancer 1.578 1.8e-16
osteosarcoma -1.099 1.3e-02
psoriasis 1.100 3.7e-09

Gene RIF (5)

AA Sequence

MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLC      1 - 70
LTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV     71 - 140
TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP                                    141 - 178
//

Text Mined References (28)

PMID Year Title