Property Summary

NCBI Gene PubMed Count 542
PubMed Score 1232.69
PubTator Score 988.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (496)

PMID Text
26894557 The NPM1 gene did not reveal any copy number alterations in acute myeloid leukemia.
26847745 Results show FLT3, NPM1, and CEBPA combination genotype confer favourable prognosis in AML
26789727 The presence of minimal residual disease, as determined by quantitation of NPM1-mutated transcripts, provided powerful prognostic information in AML independent of other risk factors.
26666953 NPM1 Mutation Detection in Acute Myeloid Leukemia
26642792 The results indicated significant differences in the integral optical density and less so in the areas of NPM+ nucleoli in leiomyosarcomas, but not in intact myometrium and leiomyomas.
26559910 NPM1 histone chaperone is upregulated in glioblastoma to promote cell survival and maintain nucleolar shape
26536659 demonstrated that p-NPM-Thr234/237 is critical in invasion and migration of hepatocellular carcinoma cells
26343305 Western blot and immunohistochemistry analysis showed that B23 was overexpressed in glioma tissues and glioma cell lines.
26231209 C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. T
26205693 This finding implicates a new role of NPM1 in conveying tumorigenic signals from the BCR-ABL oncoprotein to ribosome biogenesis, affecting cellular growth.
26123729 Overexpression of the cytoplasmic mutant of nucleophosmin (NPM) causes increased phosphorylation of NPM on T199.
26113416 a unique association was detected between NPM1 mutation status and the presence of leukemia cutis among patients with acute myeloid leukemia with monocytic features
26101160 This study shows that dysplasia evaluated by immunophenotype has no impact on clinical-biological characteristics or on outcome of NPM1 AML.
26068981 NPM1 promotes aerobic glycolysis and tumor progression in patients with pancreatic cancer by inhibiting FBP1
26055329 TRIM28 is an E3 ligase for ARF-mediated SUMOylation of NPM1.
25992555 individuals expressing specific HLA allelic groups are disposed to develop an efficient anti-Aacute myeloid leukemia immune response thanks to aberrant cytoplasmic localization of the mutated NPM protein.
25977257 Preliminary assays on NPM1-Cter-MutA, the most frequent AML-CTD mutation, revealed its significant propensity for aggregation.
25961029 In this study, we aim to explore the differences in the coexpression patterns of those NPM1-associated genes between the normal and the CML states, to further investigate the altered ribosome activities in CML
25918010 An important role of NPM in mediating the oncogenic effects of HBx and the corresponding nucleolar perturbations induced by this viral oncoprotein.
25908633 Insights into the regulation of neuronal viability by nucleophosmin/B23.
25907517 Expression of STAT5B was significantly correlated with astrocytoma tumor grade and Karnofsky Performance Scale score. High expressions of NPM, p-JAK2, and STAT5B were associated with a short survival time.
25818168 Data show that tumor sppressor protein GLTSCR2 down-regulates total nucleophosmin (NPM) expression levels by decreasing its protein stability.
25809997 CMML with NPM1 mutation shows histopathological features of CMML, but patients appear to have a high probability for AML progression and may require aggressive clinical intervention, especially in patients with a high mutation burden.
25805179 our findings provide new insights on the potential relevance of the CK2-mediated phosphorylation of B23/NPM in cancer cells, revealing at the same time the potentialities of its pharmacological manipulation for cancer therapy
25791120 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NFkappaB and JNK
25779376 The cytological features of NPM1-mutated acute myeloid leukemia.
25754892 our results revealed that, in addition to canonical autophagy, there may be NPM-dependent autophagy associated with nucleolar disruption
25749034 Authors determined the resistance profile of ASP3026 in the context of NPM/ALK+ ALCL.
25713434 Data indicate that nucleophosmin (NPM1)-positive/FLT3-internal tandem duplications-negative genotype remains a relatively favorable prognostic factor for patients with acute myeloid leukemia age 55 to 65 years but not in those age > 65 years.
25711412 NPM1 modulates the level of HMGA1 at the endogenous regulatory sequences of INSR and IGFBP1 genes.
25648021 The NPM1 mutation was significantly associated with lower relapse rate in Egyptian patients with cytogenetically normal acute myeloid leukemia.
25543261 these findings suggest that deregulated miR-21 expression may contribute to disease pathogenesis in NPM1-mutated AMLs.
25527567 The expression levels of FLT3-ITD and NPM1 and their mutational status correlate between bone marrow and peripheral blood in patients with acute myeloid leukemia.
25496916 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25468431 CEBPA mutations, and their co-occurrence with FLT3-ITD, FLT3-D835, and NPM1 mutations, are reliable genetic markers for acute myeloid leukemia.
25457413 knockdown of NPM reversed the drug resistance by down-regulating P-Glycoprotein and Akt/mTOR signal pathway, indicating that NPM may serve as a potential modulator in drug resistance.
25421715 NPM1 regulates translesion DNA synthesis via interaction with the catalytic core of DNA polymerase-eta.
25400766 Double CEBPA mutations are prognostically favorable in non-M3 acute myeloid leukemia patients with wild-type NPM1 and FLT3-ITD.
25389240 It was concluded that IMP3 and nucleophosmin cannot be a routine diagnostic marker for discrimination of papillary carcinomas and benign lesions.
25384962 Designed a real-time PCR method using 3'-modified oligonucleotides technique to detect NPM1 mutations; validated its utility in clinical samples.
25381129 NPM1 mutations were associated with acute myeloid leukemia.
25349213 a function of NPM1 in the spatial organization of nucleolus-associated heterochromatin through DNA methyltransferase DNMT3A
25349176 Data indicate a chimeric fusion involving nucleophosmin NPM1 (5q35) and TYK2 kinase (19p13) that encodes an NPM1-TYK2 protein in cutaneous CD30 antigen-positve lymphoproliferative disorders.
25348016 Induction of differentiation was associated with downregulation of Mt NPM1 and SIRT1.
25299584 The NPM1 mutation type has no impact on survival in cytogenetically normal acute myeloid leukemia.
25288641 Evidence show that mTOR-mediated phosphorylation of SENP3 facilitates the interaction with NPM1, thereby promoting nucleolar targeting.
25281355 DNMT3A has a significant dominant effect on the clinical features and outcomes of de novo acute myeloid leukemia patients with concurrent DNMT3A, FLT3 and NPM1 mutations
25242579 Data indicate that treatment with siRNA in the nucleophosmin NPM mutant cell line OCI-AML3 inhibited proliferation and induced differentiation of the OCI-AML3 cells.
25083817 High DNA-methyltransferase 3B expression predicts poor outcome in acute myeloid leukemia, especially among patients with co-occurring NPM1 and FLT3 mutations.
25079101 Mutations in FLT3, NPM1, and CEBPA provide In this review, prognostic information and have been integrated into clinical diagnostics and clinical practice for acute myeloid leukemia.
25039748 Quantification of rare NPM1 mutation subtypes by digital PCR.
25033841 This study identifies a novel mechanism through which NPM-RAR affects leukemogenesis
25026287 Positive NPM1mut MRD (defined as > 0.1% in the bone marrow) after induction and at the end of treatment also predicted a higher risk of relapse, but did not influence OS.
24991885 Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells
24895580 JAK2V617F mutation was found in 60% of the 120 classic MPNs. However, none of the patients displayed FLT3-ITD and NPM1 mutations; only 2 patients harbored DNMT3A R882 mutation
24859829 TET2 gene mutation was identified as an unfavorable prognostic factor in cytogenetically normal acute myeloid leukemia patients (cn-AML) with the NPM1+/FLT3-internal tandem duplications - mutations.
24857377 Aurora kinase B-mediated phosphorylation of NPM1 plays a critical role during mitosis.
24816240 A mutation in NPM1, predicted relapse in acute myeloid leukemia patients after induction therapy.
24801015 systematic review and meta-analysis examined 3 frequent mutations in cytogenetically normal-acute myeloid leukemia: FLT3-ITD, NPM1 and CEBPA; FLT3-ITD was associated with worse prognosis, whereas mutations in NPM1 and CEBPA genes were associated with a favorable prognosis
24796332 NPM1 favors prostate tumour cell migration, invasion and colony forming.
24793791 NPM is a downstream effector of the STAT3 signaling, and can facilitate the nuclear entry of phosphorylated STAT3.
24787960 Findings indicate that NPM plays a regulatory role in liver cancer.
24743218 Next-generation sequencing may enhance minimal residual disease detection in NPM1-mutated acute myeloid leukemia.
24724782 FLT3-ITD and NPM1 mutational status might be useful for prognosis stratification.
24716928 Nucleophosmin expression was found significantly upregulated in CRC.
24690621 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24666762 Lower frequency of NPM1 and FLT3-ITD mutations was found in a South African adult de novo acute myeloid leukemia cohort.
24616519 identified a short, arginine-rich linear motif in NPM1 binding partners that mediates Npm-N oligomerization
24596420 These data support a bystander role for the miR-10 family in NPM1 mutated acute myeloid leukemia
24576674 tight binding of NPM1/B23 to the G-quadruplex is achieved through the cooperation of both folded and unfolded regions that are individually able to bind it.
24573385 flt3 and npm1 mutations have prognostic relevance with older acute myeloid leukemia patients treated intensively or non-intensively
24515769 APE1/Ref-1 interacts with NPM1 to control the DNA damage repair system, and it is likely that this interaction plays a defining role in high-grade ovarian serous carcinoma.
24462683 B23 acts on core capsid assembly via its interaction with hepatitis B virus core dimers.
24443894 IDH1 and IDH2 mutations confer an adverse effect in patients with acute myeloid leukemia lacking the NPM1 mutation.
24413856 immunohistochemical staining for the detection of NPM1 gene mutation is a valuable prime test in acute myeloid leukemia patients
24316072 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24289551 Both of these cause abnormal cytoplasmic localization of nucleophosmin.
24288427 the prevalence and clinical characteristics of NPM1 mutations in patients of de novo acute myeloid leukemia
24220271 findings show evidence to suggest that wild-type NPM1 has an inhibitory influence on BRD4 that is relieved upon NPM1c mutation and cytosplasmic dislocation; this leads to the upregulation of the core transcriptional program facilitating acute myeloid leukemia development
24192815 The associations among NPM1 mutations, FLT3-internal tandem duplication and the surface molecular signature of leukemic cells may offer beneficial information about the pathogenesis of AML.
24183235 RXR interaction is necessary for NPM-RAR-mediated myeloid maturation arrest.
24164801 These studies may suggest low frequencies of NPM1 and FLT3-ITD mutations in acute myeloid leukemia patients from the Chinese population, and they may have a synergistic function in stimulating proliferation of leukemia cells.
24097631 it was found that FLT3-internal tandem duplication (detected in 29% of patients) did not associate with overall survival (P=0.31), whereas NPM1 mutations (30%) were associated with a significantly longer overall survival (P=0.002).
24035716 There is no correlation between NPM1 mutations and CXCR4 or pCXCR4 expression, suggesting that the CXCR4 and NPM pathways act independently in adult AML.
24004182 mutated NPM1 is a stable and reliable prognostic marker in AML and can be used to assess MRD.
23998253 This study reports a novel 3'UTR NPM1 mutation in two adult patients diagnosed with acute myeloid leukemia, which unlike the common NPM1 exon 12 mutations has an intact open reading frame but possibly affects the secondary structure and stability of mRNA.
23929838 immune responses against mutated NPM1 may contribute to a favorable prognosis in acute myeloid leukemia
23927396 These results indicate that NPM-RAR, not RAR-NPM, is the prime mediator of myeloid differentiation arrest in t(5;17) APL.
23907410 In 12 patients with MC, FLT3-ITD and NPM1 mutations were found, and these patients showed signs of hematological relapse.
23877794 Mutagenesis of cysteine 288 to alanine re-localizes NPM1 from the cytoplasm to the nucleolus and attenuates the sensitivity of cells expressing this mutation to bortezomib and arsenic trioxide.
23874639 Nucleophosmin1 is a negative regulator of the small GTPase Rac1.
23874603 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23831574 defects in the APE1-NPM1 interaction can be associated with the genomic instability observed in tumors, which supports the concept that interfering with this interaction may sensitize cancer cells to chemotherapy and radiotherapy.
23814019 NPM-ALK-mediated phosphorylation of PKM2 and metabolic reprogramming has a role in anaplastic large cell lymphoma
23763915 Elderly AML patients with NPM1-MUT/FLT3-WT genotype have significantly improved outcomes compared with patients with other NPM1/FLT3 genotypes when treated with cytotoxic chemotherapy.
23753029 NPM1 is rarely present with RUNX1 mutations in acute myeloid leukemia patients, but they are both prersent in this unusual study.
23742937 Nucleophosmin binds preferentially high-order G-quadruplexes, an interaction that is hampered by acute myeloid leukemia-associated mutations.
23730215 Dual mutation of Tyr644 and Tyr664 in Nucleophosmin-anaplastic lymphoma kinase(NPM-ALK)abrogates its physical association with IGF-IR.
23716555 Cytoplasmic nucleophism localization is not always caused by a conventional nucleophosmin 1 mutation in acute myeloid leukemia.
23704090 Persistence of DNMT3Amut in 5 patients who lost NPM1mut at relapse suggests that DNMT3Amut may precede NPM1mut in acute myeloid leukemia pathogenesis.
23666693 (PCR)-based fragment length analysis for mutations in FLT3 and NPM1 has been shown to be a fast and sensitive method
23656730 Increase of more than 1% NPM1mut/ABL1 was most prognostic for relapse of acute myeloid leukemia after chemotherapy, whereas an increase of more than 10% NPM1mut/ABL1 was most prognostic for relapse after allogeneic transplantation.
23618861 Data indicte that the 70-residue construct of nucleophosmin (NPM1) displays a detectable residual structure in its denatured state.
23601747 NPM1-mutated acute myeloid leukemia of monocytic or myeloid origin exhibit distinct immunophenotypes.
23591014 although cytoplasmic expression of NPM1 (NPMc+)can be used as a marker for diagnosing relapsed disease, it is not correlated with NPM1 mutation and should not be used by clinicians as a prognostic marker for risk assessment.
23590662 Studies indicate that subtyping of acute myeloid leukemia requires an integration of information from the patient's clinical history, cytogenetic findings, and the mutation status of particular genes NPM1, FLT3, and CEBPA.
23544830 Requirements for the interaction of NPM1 and APE1 are characterized along with their binding to undamaged nucleic acids.
23540998 Patients with NPM1mut/FLT3-ITD- had the best prognosis in terms of higher CR, OS, and DFS, while those with NPM1mut/FLT3-ITD+ had the worst CR rate, and NPM1wt/FLT3-ITD+ had the lowest OS and DFS.
23536448 The differential expression of NPM1 along the normal colon-adenoma-carcinoma progression and its involvement in resisting p53 related senescent growth arrest in colorectal cancer (CRC) cell lines implicate its role in supporting CRC tumorigenesis
23511494 NPM1 mutations are associated with better complete remission in pediatric acute myeloid leukemia.
23496932 Among NPM1-mutated acute myeloid mutation, the antigen expression pattern of HLADR(+) CD34(+) CD7(+) is associated with a poor prognosis, independent to the FLT3-ITD mutation.
23489260 Nucleophosmin/B23 is a favorable prognostic indicator for gastric cancer, but Her-2/neu has no relationship with prognosis.
23483572 Depletion of NPM inhibited proliferation of Ewing's sarcoma cells.
23436734 This review focuses on the leukemia-associated NPM1 C-terminal domain and describes its structure, function, and the effect exerted by leukemic mutations. [review]
23435463 NPM1 mutation perturbs megakaryopoiesis and is associated with acute myeloid leukemia.
23403313 Data indicte that acute myeloid leukemia (AML) with NPM1-MLF1 and AML with NPM1 mutations showed similar immunophenotypical and molecular features, including gene mutation patterns and gene expression profiling (GEP).
23393136 enhanced HDM2 expression induced by mutant NPM1 may have a role in MEF/ELF4-dependent leukemogenesis
23377436 Effect of FLT3 burden is modulated by NPM1 mutation, especially in patients with a low ratio.
23364796 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23338972 Our investigation of the mechanisms underlying the decrease in miR-26a in this lymphoma revealed novel evidence that STAT3, a major downstream substrate of NPM-ALK tyrosine kinase activity, suppresses MIR26A1 gene expression.
23328624 A direct correlation between NPM1 G-quadruplex binding at rDNA and its nucleolar localization.
23301224 Two of the 3 non-A type NPM1 mutations were novel: c.867_868insAAAC and c.869_873indelCTTTAGCCC.
23285058 Evaluating different RPS9 fragments for their ability to bind NPM1 indicated that there are two binding sites for NPM1 on RPS9.
23271972 the essential role of NPM1 in chaperoning EBNA2 onto the latency-associated membrane protein 1 (LMP1) promoters, which is coordinated with the subsequent activation of transcriptional cascades through RBP-Jkappa during EBV infection.
23238897 Association of cup-like nuclei in blasts with FLT3 and NPM1 mutations in acute myeloid leukemia.
23232117 this study reports a biophysical characterization of NPM1 and of its domains in order to gain insights into the role that inter-domain interactions plays in the protein stabilization.
23183427 delineate a new NPM1-HAUSP molecular interaction controlling PTEN deubiquitination and trafficking
23154527 detection of recurrent gene rearrangements,or NPM1 and FLT3 gene mutations in AML patients with both NK or without cytogenetic result add clinically relevant information, and thus enable reclassification of patients to a different prognostic risk group.
23125841 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23065518 A polymorphism in the 3'-untranslated region of the NPM1 gene causes illegitimate regulation by microRNA-337-5p and correlates with adverse outcome in acute myeloid leukemia.
23064464 inhibition of PDGFRA and PDGFRB in a patient with refractory late-stage NPM-ALK+ Anaplastic large cell lymphoma resulted in rapid, complete and sustained remission
23020761 Our data demonstrate that NPM1-mutated cytogenetically normal AML originates in an early stem cell with both lymphoid and myeloid differentiation potential.
23019224 Findings define a mechanism through which control of the DDX31-NPM1 complex is likely to play critical roles in renal carcinogenesis.
22996295 Mutations in NMP1 gene is associated with pediatric acute myeloid leukemia.
22968966 Mutated NPM1 is abnormally expressed in the cell cytoplasm in the cohort of patients with acute myeloid leukemia.
22926011 Ihis study provides the first link between estrogen exposure and NPM/B23 expression in endometrial cell proliferation.
22914610 CD123 expression in acute myeloid leukemia is associated with underlying FLT3 and NPM1 mutations.
22911473 Study indicates that allo-HSCT and auto-HSCT provide similar outcomes compared with chemotherapy as consolidation for NPM1+/FLT3-ITD- NK-AML patients.
22906848 lack of impact or unfavorable prognostic effect of NPM1 mutations found can be assigned to a small cohort of analyzed acute myeloid leukemia patients, as can the presence of FLT3 and IDH mutations that cooperate with NPM1 mutations influencing prognosis.
22851180 the aberrant feed-forward pathway that keeps eIF4E and C/EBPalphap30 elevated in NPM1(+/-) cells contributes to the MDS phenotype associated with NPM1 deficiency.
22791379 NPM1 mutations occur rarely or not at all in chronic myeloid leukemia patients in chronic phase or blast crisis.
22761710 High NPM1 expression is associated with multiple myeloma.
22745010 In a large data set of glioblastoma multiforme patients, both GRP78 and NPM1 genes were upregulated and presented a tendency to shorter overall survival time.
22733614 genetic association studies in population in Western India: Data suggest that distinct prognostic subclasses of adult patients with acute myeloid leukemia can be identified based on the presence of mutations in NPM1 and fetal liver kinase 3.
22717133 Adenoviral protein V participates in a process of viral assembly through NPM1.
22707729 present the solution structure of the NPM1-C70 domain and NMR analysis of its interaction with a c-MYC-derived G-quadruplex. These data were used to calculate an experimentally restrained molecular docking model for the complex
22665062 NPM is necessary for the ability of c-Myc to induce rRNA synthesis in the nucleolus, and constitutive NPM overexpression stimulates c-Myc-mediated rRNA synthesis.
22631075 The current study uncovered the critical role of NPM1 in the regulation of colon cancer cells migration and invasion, and NPM1 may serve as a potential marker for the prognosis of colon cancer patients
22592607 NPM1(mut) induces specific T-cell responses of CD4(+) and CD8(+) T cells and therefore is a promising target for specific immunotherapies in acute myeloid leukemia.
22573554 study suggesst that B23 phosphorylation is related to cellular processes such as apoptosis, cell survival, cell proliferation, and response to DNA damage stimulus, in which these kinases are involved
22528486 a mechanistic link between elevated NPM1 expression and depressed ATF5 in HCC and suggests that regulation of ATF5 by NPM1 plays an important role in the proliferation and survival of HCC.
22494415 Data indicate there was a strong association of IDH2 mutation with NPM1 mutations and a trend with FLT3-internal-tandem duplication.
22487825 FLT3-mut (420 bp) is longer than FLT3-wt (327-332 bp), and NPM1-mut (172 bp) is longer than NPM1-wt (168 bp).
22481022 In patients with CN-AML, characteristic flow cytometric profile is associated with NPM1 and FLT3 mutation status.
22475129 NPM-molecular relapse (NPM-rel) is always followed by hematological relapse (H-rel), but longitudinal studies of NPM mutations may predict an impending H-rel earlier than flow cytometric- or WT1-based methods.
22467873 GRK5 phosphorylates Ser-4 in nucleophosmin and regulates the sensitivity of cells to PLK1 inhibition.
22454318 Parallel assessment of MRD by next-generation sequencing and quantitative real-time polymerase chain reaction in NPM1 mutated patients was concordant in 95% of analyzed samples (n = 38).
22451695 data demonstrate that NPM is a strong activator of AurA kinase activity at the centrosome and support a novel mechanism of activation for AurA
22397365 NPM1 mutation is associated with acute myeloid leukemia.
22374696 The FLT3ITD mRNA level contributes to relapse risk stratification and might help to guide postremission therapy in NPM1-mutated acute myeloid leukemia.
22362753 Characterization of the sperm chromatin decondensation and nucleosome assembly activities of homo- and hetero-oligomers of NPM1,NPM2 and NPM3.
22362118 The presence of a moCEBPA mutation was shown to be associated with prolonged survival in NPM1 mutated cytogenetically normal-acute myeloid leukemia patients.
22337638 B23 regulated the association of viral core proteins and cellular histones with the virus genome.
22193965 changes in the subcellular localization of NPM, due to alterations in the relative abundance of NPM and NPM-MLF1 proteins, may contribute to the enhanced myeloid progenitor activity of Npm +/- cells
22174317 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22174271 propose that the N-terminal oligomerization domain of Npm has evolved energetic switches within its structure to enable transformation to a disordered state through phosphorylation
22126574 NPM1 mutations may not be significantly involved in the pathogenesis of acute myeloblastic leukemia in Thai children
22104247 normal karyotype acute myeloid leukemia patients with non- A-type NPM1mut, regardless of FLT3mut status, and patients with NPM1mut in the absence of FLT3-ITD have higher complete remission rates than patients with NPM1wt and FLT3mut
22099964 Two novel NPM-1 gene mutations identified in Egyption acute myeloid leukemia patients.
22002061 B23 may function in the assembly of the kinetochore complex by interacting with CENP-W during interphase
21986840 the cellular context in which HOX/MEIS1 is overexpressed appears to be very important, and other relevant genes are most likely required as well to maintain the expanding capacity of the CD34thorn NPMcthorn acute myeloid leukemia cells
21979956 in cancer cells NPM interacts with FOXM1 and their interaction is required for sustaining the level and localization of FOXM1.
21933585 Nucleophosmin mRNA and protein are expressed in glandular epithelium of human endometrium throughout the menstrual cycle.
21904378 Investigation of the associations between NPM-1 mutations and acute myeloid leukemia cell differentiation as defined by a limited number of well-characterized surface membrane molecules.
21880628 Integrative nucleophosmin mutation-associated microRNA and gene expression pattern analysis identifies novel microRNA - target gene interactions in acute myeloid leukemia.
21860418 mutated NPM1, a prognostic marker for long-term survival, correlated with p53 isoforms beta and gamma expression
21822216 NPM1 has an important role in poly(A) tail length determination and may help network 3' end processing with other aspects of nuclear mRNA maturation
21809990 The qPCR assay demonstrated a higher analytical sensitivity than the capillary electrophoresis for detection of nucleophosmin 1 mutations.
21789382 results show that hotspot mutations in the PI3K, JAK2, FLT3 and NPM1 genes are not common in myelodysplastic syndrome patients.
21784052 NPM1 mutant AML samples were shown to markedly overexpress miR-10a. An inverse association between miR-10a and MDM4 expression exists in intermediate-risk AML samples with respect to their NPM1 mutational status.
21765024 NPM-ALK induces expression of the growth-promoting receptor ICOS.
21763502 Acetylation of NPM1 was found to be critical for nuclear localization of Tat.
21763502 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21744003 Data show that the presence of mutations of NPM1 and FLT3-ITD significantly decreased with age in adult acute myeloid leukemia.
21719597 Attenuating levels or oligomerization of NPM1 selectively induces apoptosis and sensitizes NPM1c+ expressing AML cells to treatment with ATRA and cytarabine.
21705779 NPM was identified as being involved in the regulation of rpL3 gene expression via alternative pre-mRNA splicing.
21703420 NPM-ALK Deregulates MSH2 and suppresses DNA mismatch repair function and is associated with lymphoma.
21689627 NPM has a tumor suppressive role in breast cancer
21666141 Adding locked nucleic acid probes to existing assays is a simple way to enhance and confirm the detection of NPM1 mutations, especially those at low levels.
21660047 nucleolar translocation of RelA is causally involved in the relocalization of nucleophosmin from the nucleolus to the cytoplasm
21621842 FLT3-ITD and NPM1mut might synergistically stimulate blast proliferation.
21606167 White blood cell count had a significant impact on complete remission rate, event-free survival and overall survival in patients with the genotypic combination 'NPMc(+) with FLT3-ITD'.
21577323 Trisomy 11 is associated with a poor prognosis in patients with acute myeloid leukemia but no evidence of NPM1 or KIT mutations were identified.
21555683 NPM1(mut) may have a role in acute myeloid leukemia relapse and death
21537492 Results indicate that down-regulation of NPM1 expression inhibits leukemic cells proliferation, blocks cell cycle progression and induces cellular apoptosis.
21537333 for risk estimation in NPM1 mutated acute myeloid leukemia not only the FLT3-ITD status, but also the FLT3-ITD load has to be taken into account.
21518927 p16INK4a/pRb may function as an alternative pathway of NPM-alk oncogene-induced senescence; the reactivation of p16INK4a expression might be a novel strategy to restore the senescence program in some tumors.
21516736 The findings allow AML patients with a normal karyotype and the FLT3-ITD-/NPM-genotypes to be identified as a poor prognosis group.
21492127 NPM1 down-regulation is rare in early MDS subtypes with the del(5q), but is common in advanced MDS with the del(5q) & is associated with a complex karyotype. This may be related to a concomitant increase in genomic instability in these cases.
21441929 Activation of a humanized Npm1c knock-in allele in mouse hemopoietic stem cells causes Hox gene overexpression, enhanced self renewal and expanded myelopoiesis. One third of mice developed delayed-onset AML.
21425800 Data show that the multifunctional histone chaperone NPM1 interacts with linker histone H1 through its first acidic stretch (residues 120-132).
21425800 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21418451 Taspase1 appears to exploit the nuclear export activity of importin-alpha/nucleophosmin to gain transient access to the cytoplasm required to also cleave its cytoplasmic substrates.
21393327 Findings suggest that NPM1 haploinsufficiency may have a role in myeloid malignancies associated with large 5q- deletions contributing to MDS development likely through genetic instability.
21338238 NMP1 mutations are associated with acute myeloid leukemia.
21331074 NPM1 mutation is associated with acute myeloid leukemia.
21316727 The authors found that herpes simplex virus 1-induced dispersal of B23 was dependent on UL24.
21310483 High NPM1 protein is associated with relapsed/refractory acute leukemia.
21278791 Studies indicate that increased NPM expression is associated with different types of solid tumors whereas an impairment of NPM function is characteristic of a subgroup of hematolologic malignancies.
21258971 In thyroid cancer cell lines nucleophosmin localizes both in the nucleolus and in nucleus, while in non-tumorigenic thyroid cell lines localizes only in nucleolus.
21245599 Data showed a high frequency of NPM1 mutations in the monocytic subtypes of acute myeloid leukemia, and a high degree of association between occurrence of NPM1 and FMS-like tyrosine kinase-3 (FLT3) internal tandem duplication mutations.
21245151 analysis of binding of NPM1, TRIM28, and YB-1 to the Mf2 domain of IRF-1
21233837 NPM1 mutations are involved in the transformation from myelodysplastic syndromes to acute myeloid leukemia or myeloproliferative neoplasms to blast phase.
21183700 NPM1 mutation is associated with multilineage dysplasia in de novo acute myeloid leukemia.
21182834 Data suggest that Akt2/B23 functions as an oncogenic unit to drive tumorigenesis of A549 lung cancer cells.
21173125 FLT3 and NPM1 mutations are rare in myelodysplastic syndromes, but assessment of mutation status is potentially useful for predicting progression to acute myeloid leukemia.
21122805 NPM gene mutations promote NIH3T3 cell migration and invasion through CXCR4 and MMPs.
21102525 These results identify a novel cell-transforming property of NPM/ALK, namely its ability to induce the expression of HIF1alpha, a protein with an important role in carcinogenesis
21084279 results suggested that a complex consisting of BRCA2, NPM, and ROCK2 maintains the numerical integrity of centrosomes and accurate cell division and that dysfunction of this regulation might be involved in the tumorigenesis of breast cancer
21045017 Serine phosphorylation of NPM-ALK, contributes to its oncogenic potential.
21030560 NPM1-mutated AML is a founder genetic event that defines a distinct leukemia entity accounting for approximately one-third of all AML.
20981679 the prognostic relevance of NPM1-based monitoring of minimal residual disease (MRD) in peripheral blood (PB), bone marrow (BM), and in specific cell subsets (CD34(+), CD34(-), CD34(dim)) of BM
20981679 Observational study of gene-disease association. (HuGE Navigator)
20979630 role of different types of NPM1 mutations, either individually or in the presence of other common gene mutations may be essential for childhood AML prognosis.
20962268 NPM is dephosphorylated on various threonine residues (Thr199 and Thr234/237) in response to UV-induced DNA damage.
20924036 NPM1 methylation is rare in human myelodysplastic syndrome and does not play a major role in its pathogenesis
20880116 Observational study of gene-disease association. (HuGE Navigator)
20877721 NPM1 deletion is associated with chromosomal rearrangements in leukemia.
20875872 Immunophenotype and NPM1/FLT3 gene mutation status did not change between presentation and relapse in 83% (10 of 12) and 94% (15 of 16) cases, respectively.
20872983 NPM1 mutation may be a favorable prognostic factor for overall survival and relapse-free survival in the presence of FLT3/ITD in acute myeloid leukemia patients.
20864535 Cytoplasmic FANCA-FANCC complex was essential for NPMc stability.
20858903 NPM1 C-terminal domain interacts with G-rich quadruplex forming DNA.
20855646 nuclear invagination blasts can be reliably identified in routine smears in acute myeloid leukemia and although they are a specific marker of NPM1 mutation-positive cases, the majority of NPM1 mutation-positive cases lack this distinctive finding.
20849383 Data show that MRD monitoring with qPCR for the NPM1 mutation and chimerism from non-separated PB contributes to surveillance in patients with AML in the post-transplant period, but failure to detect the mutation in PB.
20807181 NPM/B23 plays an important role in protecting cells from radiation-induced apoptosis and increasing polyploidy formation via either a p53 or non-p53 pathway.
20803351 Observational study of gene-disease association. (HuGE Navigator)
20802533 Authors propose that FBP1 is a key regulator of cell growth and proliferation through its ability to selectively bind the NPM 3' UTR and repress NPM translation.
20724983 Mutations in NPM1 is associated with acute myeloid leukemia.
20713529 Findings suggest that phosphorylated NPM1 is a novel component in DSB repair that is recruited by ubiquitin conjugates downstream of RNF8 and RNF168.
20713446 depletion of upstream binding factor (UBF; an rRNA transcription factor) decreased the chromatin binding affinity of B23, which in turn led to an increase in histone density at the r-chromatin
20684989 Results confirm the favorable impact of NPM1 mutations and identify the adverse prognostic relevance of CD56 expression in this subgroup of AML.
20678218 Mutations in NPM1 are associated with acute myeloid leukemias.
20678218 Observational study of gene-disease association. (HuGE Navigator)
20673208 Two closely related nucleophosmin isoforms were isolated from cell nuclei.
20651067 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634376 the CD34(+) fraction in NPM1-mutated AML belongs to the leukemic clone and contains NPM1-mutated cells exhibiting properties typical of leukemia-initiating cells
20616361 results show that the assay is a versatile and specific tool for the screening of NPM1 mutations in patients with acute myeloid leukemia
20616361 Observational study of genetic testing. (HuGE Navigator)
20606168 The NPM mutant specifically inhibits the activities of the cell-death proteases, caspase-6 and -8, through direct interaction with their cleaved, active forms, but not the immature procaspases.
20592250 Observational study of gene-disease association. (HuGE Navigator)
20554525 active NPM-ALK, but not a kinase-dead mutant, bound and induced Grb2 phosphorylation in tyrosine 160
20546020 higher ERG expression in NPM1-unmutated patients than in NPM1-mutated patients. The level of ERG expression had no independent effect on the survival in normal karyotype AML patients
20546020 Observational study of gene-disease association. (HuGE Navigator)
20542566 report describes the immunophenotypic and genetic characteristics of a consecutive series of NPM-mutated de novo acute myeloid leukemia patients enroled in the CETLAM trial
20533335 Six proteins were detected as up-regulated in higher grade astrocytomas and the most important finding was nucleophosmin (NPM) (p<0.05), whereas four proteins were down-regulated, among them raf kinase inhibitor protein (RKIP) (p<0.05).
20520634 Observational study of gene-disease association. (HuGE Navigator)
20515654 these data demonstrate for the first time that nucleophosmin is overexpressed in thyroid tumors, as an early event of thyroid tumorigenesis.
20513120 Observational study of gene-disease association. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
20506166 Results prove that nucleophosmin is a nuclear matrix protein, and is localized in nuclear matrix fibers.
20494930 Observational study of gene-disease association. (HuGE Navigator)
20471513 NPM1 gene rearrangement is associated with acute myeloid leukemia.
20464055 NPM1 gene mutation was detected in 39% of acute myeloid leukemia patients.
20464055 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20439648 CEBPA-double patients hwith acute myeloid leukemia had evidence of a lower coincidence with FLT3/ITDs (P = .04) and were highly unlikely to have an NPM1 mutation (P < .0001).
20439648 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20428199 NPM1 mutations are associated with acute myeloid leukemia.
20424160 Results support the notion that the tumor suppressor effects of SHP1 on NPM-ALK are dependent on its ability to bind to this oncogenic protein.
20404347 B23 regulates microtubule dynamics by directly inhibiting Eg5 ATPase activity
20393185 Data show that the TNF/Fas/TRAIL pathway is modulated by nucleophosmin-anaplastic lymphoma kinase in anaplastic large cell lymphoma.
20368538 Observational study of gene-disease association. (HuGE Navigator)
20368469 Observational study of gene-disease association. (HuGE Navigator)
20352051 NPM/B23 is a direct target of Plk2 in the regulation of centriole duplication and that phosphorylation on serine 4 can trigger this process
20338617 Local recurrence was associated with higher expression of nucleophosmin (P = .0233), and disease-free survival rate from oral squamous cell carcinoma was significantly better in patients with low expression of nucleophosmin
20333249 NPM is a critical regulator of Kaposi sarcoma herpesvirus latency via functional interactions with v-cyclin and LANA
20306250 The NPM1 gene is mutated in about 30% of acute myeloid leukemias. Mutations change the C-terminus of the NPM1 protein that are responsible for the aberrant nuclear export & accumulation of NPM1 mutants in the cytoplasm of leukemic cells. Review.
20237420 NSP 5a3a's novel interaction with B23 and ribonuclear protein hnRNP-L implicates NSP 5a3a in cellular processes such as ribosome biogenesis and rRNA transcription .
20212148 folding of the C-terminal domain of NPM1 proceeds via an extended nucleus, and the denatured state retains significant malleable structure at the interface between the second and third helices
20203266 NPM1 mutations are associated with acute myeloid leukemia.
20172040 Study suggest that BuI regimen results in favorable clinical outcome in patients with isolated NPM1 mutation.
20172040 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20145123 HLJ1 switches the role of NPM1, which can act as tumor suppressor or oncogene, by modulating the oligomerization of NPM1 via HLJ1-NPM1 heterodimer formation and recruiting AP-2alpha to the MMP-2 promoter.
20137111 npm1 mutation is a favorable independent prognostic factor for adult AML patients with normal cytogenetics under conditions without FIT3 gene mutation.
20127469 Using the BIAcore analysis system, the authors were also able to deduce that the nucleophosmin B23.1 residues 259-294 were required for the interaction between hepatitis B virus core antigen Cpl49 and B23.1 in vitro.
20073075 Analyzed gene-expression profiles of patients with previously untreated multiple myeloma. NPM1 was found to be upregulated in hyperdiploid multiple myeloma.
20027629 Overexpression of Nucleophosmin is associated with colorectal carcinoma, melanoma and breast carcinoma.
20026798 Mutations in the NMP1 gene is associated with favorable outcome in patients with cytogenetically normal acute myeloid leukemia.
20023256 Cytoplasmic NPM1 immunoreactivity predicts NPM1 mutations and warrants inclusion in the routine diagnostic and prognostic workup of acute myeloid leukemia.
20023256 Observational study of gene-disease association. (HuGE Navigator)
20011973 The physical interaction between B23 and PES1 implies that they may participate in ribosome biogenesis in a protein complex.
20001230 Observational study of gene-disease association. (HuGE Navigator)
19965647 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19901261 Strikingly different molecular relapse kinetics in NPM1c, PML-RARA, RUNX1-RUNX1T1, and CBFB-MYH11 acute myeloid leukemias.
19887368 The kinase activation loop in NPM-ALK regulates its tyrosine phosphorylation pattern.
19865112 NPM1 mutations were mutually exclusive with ASXL1 alterations in acute myeloid leukemias.
19865112 Observational study of gene-disease association. (HuGE Navigator)
19843866 PADI4 citrullinates NPM1 at arginine 197 residue and regulates subcellular localization of NPM1
19824900 Observational study of gene-disease association. (HuGE Navigator)
19775300 study of FLT3-associated biological parameters in acute myeloid leukaemia; phospho-STAT5 was reduced in FLT3-internal tandem duplication(ITD)/cytoplasmic nucleophosmin NPMc+ mutation group suggesting NPMc+ may oppose FLT3-ITD-dependent activation of STAT5
19770764 Studies indicate that AML with mutated NPM1 is a leukemia entity with distinct molecular, pathological, and prognostic features.
19734942 RNA aptamers interfering with nucleophosmin oligomerization induce apoptosis of cancer cells.
19694479 Studied vertebrate cells with compromised Chk1 function; only one protein, the histone chaperone nucelophosmin, was altered consistently in line with changes in chromatin-associated Chk1 and increased in response to DNA damage.
19679658 Data suggest that nucleophosmin/B23 recruits USP36 to nucleoli, thereby serving as a platform for the regulation of nucleolar protein functions through ubiquitylation/deubiquitylation.
19679565 Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4.
19672946 patients who had AML with cuplike nuclei were associated significantly with npm1 mutations
19672946 Observational study of gene-disease association. (HuGE Navigator)
19642896 Data show that increased level of NPM/B23 in conjunction with decreased level of IRF1 could aid GAGE-induced resistance to IFN-gamma.
19638589 NPM knockdown reduces heat-induced inhibition of DNA DSB repair.
19637342 Observational study of gene-disease association. (HuGE Navigator)
19587375 Minimal residual disease levels assessed by NPM1 mutation-specific RQ-PCR provide important prognostic information in AML.
19581289 Acetylated NPM1 transcriptionally regulates genes involved in cell survival and proliferation during carcinogenesis.
19569254 NPM1 mutations have also shown great stability during disease evolution, and therefore represent a possible marker for minimal residual disease detection.
19557552 NMP1 mutations were found in 1/37 childhood AML patients. Various NPM1 gene mutation types are associated with childhood AML.
19557552 Observational study of gene-disease association. (HuGE Navigator)
19540590 Observational study of gene-disease association. (HuGE Navigator)
19536888 Observational study of gene-disease association. (HuGE Navigator)
19535344 NPM-ALK kinase has a role in the regulation of responsiveness of tumor cells with cdk dysregulation
19531656 The NPM/ALK alteration affects diverse cellular pathways, and provide novel insights into NPM/ALK-positive anaplastic large cell lymphoma pathobiology.
19522705 Inhibiting Crm1 in early metaphase causes the formation of excess acentriolar spindle poles containing NuMA and B23, but does not affect centrosome numbers.
19484332 Non-A type nucleophosmin 1 gene mutation predicts poor clinical outcome in de novo adult acute myeloid leukemia: differential clinical importance of NPM1 mutation according to subtype.
19454010 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
19429869 NPM1 mutation is associated with acute myeloid leukemia.
19423729 identified novel reciprocal functional interactions between IGF-IR and NPM-ALK
19379554 Observational study of gene-disease association. (HuGE Navigator)
19369962 study reports on 20 cases with acute myeloid leukemia (AML) with limited differentiation; all of these cases were shown to carry an NPM1 type A mutation
19365794 2 novel NPM1 mutants in de novo AML add new insights into the heterogeneity of genomic insertions at exon 12.
19365794 Observational study of gene-disease association. (HuGE Navigator)
19351769 nucleophosmin is a candidate of independent prognostic marker for Ewing's sarcoma patients
19339032 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
19309322 Observational study of gene-disease association. (HuGE Navigator)
19289604 Folding and unfolding kinetics of the C-terminal domain. This small helical domain folds via a compact denatured state, displaying a malleable residual structure.
19286999 NPM-ALK-induced activation of the PI3-kinase and Jun N-terminal kinase and stress-activated protein kinase proteins, with a role for these in the regulation of p53 activity in an intricate signaling system
19279329 In (NK) AML patients, complete remission rates and percentage of patients with adequate in vivo blast cell reduction 1 week after the end of the first induction cycle were significantly higher in NPM1(+) patients, but were unaffected by FLT3-ITD status.
19279329 Observational study of gene-disease association. (HuGE Navigator)
19242062 NPM1 gene mutations are associated with acute myeloid leukemia.
19242062 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19221506 nucleophosmin as a positive post-translational regulator of p21.
19188445 A novel interaction between nucleophosmin (NPM1) and APE1 was characterized.
19160485 The ribosomal protein L23 is a negative regulator of Miz1-dependent transactivation.
19151774 Observational study of gene-disease association. (HuGE Navigator)
19149558 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
19131589 these data highlight the functional diversity of NPM-ALK and provide new research directions for the study of the biology of this oncoprotein.
19103589 NPM is essential for cell viability, these data suggest that targeting of NPM by granzyme M may contribute to tumor cell eradication by abolishing NPM function.
19066330 nucleophosmin is consistently cytoplasmic in NPMc(+) AML (because of the presence of NPM1 mutations), whilst it is nucleus-restricted (predictive of a germline NPM1 gene) in blastic plasmacytoid dendritic cell neoplasm
19059939 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19055671 limiting the usefulness of the NPM1 mutation A mutation as a molecular marker in patients with minimal residual disease in acute myeloid leukaemia
19052985 NPM1 expression levels of mRNA and protein in myelodysplastic syndromes were not related to chromosome 5 abnormalities and were almost the same as those in normal bone marrow and acute myeloid leukemia cells
19020547 NPM1 mutations confer a favorable prognosis in childhood AML and in cytogenetically normal AML in particular.
19020547 Observational study of gene-disease association. (HuGE Navigator)
19015314 Nucleolar protein B23/nucleophosmin regulates the vertebrate SUMO pathway through SENP3 and SENP5 proteases.
19005479 The 2 physiological nuclear export signal motifs mediated NPM1 homo/heterodimerization, influencing subcellular distribution of NPM1wt, mutated NPM1 and p14(ARF) in a 'dose-dependent tug of war' fashion. This event is critical for leukaemogenesis.
18951898 These findings indicate that nucleophosmin is essential for mitotic progression and cell proliferation.
18845790 ATIC associated with nucleophosmin-ALK, and its phosphorylation required ALK activity. ALK-mediated ATIC phosphorylation enhanced its enzymatic activity.
18775548 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
18729828 NPM is an essential protein not only for the formation of normal nucleolar structure, but also for the maintenance of regular nuclear shape in HeLa cells.
18726096 38.9% (14/36) patients with NPM1 mutations simultaneously exhibited internal tandem duplications in the FLT3 gene
18726096 Observational study of gene-disease association. (HuGE Navigator)
18641025 NPM1 mutants coexisted mainly with FLT3 mutants
18639523 SMT3IP1 desumoylates nucleophosmin and might controls its physiological functions at both the nucleolus and other subcellular compartments.
18603563 Model fits with the hypothesis that acute myeloid leukemia arises from an NPM1 mutation with haploinsufficiency of the wild-type NPM1 allele.
18596743 detailed cytogenetic analysis of acute myeloid leukaemia with mutated NPM1 in a father and daughter, with different NPM1 mutations
18590714 The NPM1-mutated is specific of leukemic cells and shows higher levels at MRD in AML patients presentation.
18559874 Observational study of gene-disease association. (HuGE Navigator)
18511415 structural analysis of nucleophosmin mutations in acute myeloid leukemia
18478020 review of mutations of NPM1 associated with AML and the implications for prognosis
18454140 p53-Driven apoptosis limits centrosome amplification and genomic instability downstream of NPM1 phosphorylation
18448670 Nucleophosmin is a binding partner of nucleostemin in human osteosarcoma cells
18420587 B23 selectively stores, and protects ribosomal protein S9 in nucleoli and therefore could facilitate ribosome biogenesis.
18371977 NPM binds to HEXIM1 in vitro and in vivo, and functions as a negative regulator of HEXIM1.
18367491 NPMc(+) acute myeloid leukemia represents a primary event rather than a transformation stage of NPMc(-) acute myeloid leukemia
18332108 B23 was found to be associated with the rRNA gene chromatin. Small-interfering-RNA-mediated down-regulation of the B23 expression level resulted in reduction of the transcription rate of the rRNA gene.
18316603 c-Jun translocates B23 and ARF from the nucleolus after JNK activation by means of protein interactions
18308931 These results identify a unique miRNA signature associated with Acute myeloid leukemia (AML) carrying NPM1 mutations and cytoplasmic nucleophosmin (NPMc+ AML) and provide evidence that support a role for miRNAs in the regulation of HOX genes.
18298902 Association of nucleophosmin with bladder cancer recurrence based on immunohistochemical assessment is reported.
18273044 NPM1 mutations were observed in 7 of 51 patients presenting as overt therapy-related acute myeloid leukemia as compared to only 3 of 89 patients presenting as therapy-related myelodysplasia
18268276 study confirms in 2562 patients with acute myeloid leukemia the previous observation that NPM1 mutations and cytoplasmic nucleophosmin are mutually exclusive of recurrent genetic abnormalities
18268276 Observational study of genotype prevalence. (HuGE Navigator)
18261272 Observational study of gene-disease association. (HuGE Navigator)
18259216 These results define SENP3 as an essential factor for ribosome biogenesis and suggest that deconjugation of SUMO2 from NPM1 by SENP3 is critically involved in 28S rRNA maturation.
18214681 The present investigations demonstrate the importance of exposure of the C-terminus of Bax for its interaction with nucleophosmin. These protein-protein interaction assays provide a technical approach for the study of Bax-interacting proteins.
18200037 NPM1-mutated acute myeloid leukaemia occurring in JAK2-V617F+ primary myelofibrosis.
18192111 In this general and unselected AML patient population, NPM1 mutation was not a prognostic indicator of a favorable outcome.
18192111 Observational study of gene-disease association. (HuGE Navigator)
18180033 findings point to DR negativity as another phenotypic feature of AML with NPM1 mutation
18165222 a molecular mechanism of B23 in the mitotic inhibition of GCN5-mediated histone acetylation and transactivation.
18081718 Observational study of gene-disease association. (HuGE Navigator)
18081718 Elderly (range 60-85 yr) but medically fit patients with acute myeloid leukemia (AML) carrying NPM1 mutations demonstrate a higher rate of complete remission compared to NPM1 wildtype AML patients.
18059485 NPM1 mutation is a unique genetic event that is specific to Acute myeloid leukemia
18037965 Could regulate androgen receptor (AR) functions by promoting assembly of AR-containing regulatory complexes; high levels might alter AR functions in prostate cancer.
17998938 Fusion protein nucleophosmin (NPM)-ALK activates GTPase Rac1 via phosphatidylkinase 3-kinase (PI3K) and protein-tyrosine kinase c-src (Src) in anaplastic large cell lymphoma patients.
17990177 NPM1 mutations were not detected in the 28 patients with myelodysplastic syndrome and acute myeloid leukemia with chromosome 5 abnormalities.
17972951 correlation of PTPN11 mutations with NPM1 mutations and FLT3/ITD among adult AML patients
17968318 nucleolar localization determines the stability of ARF but not its primary function
17957027 There was a highly significant trend for worsening in relapse risk (RR) and overall survival (OS) with increasing FLT3/ITD (internal tandem duplication) mutant level.
17957027 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17951246 B23 distinctively binds Ebp1 isoforms and regulates cell proliferation and survival through p42 and p48, respectively.
17943167 AML cells are a major source of Ang-1 in leukemic bone marrow, especially in patients with NPM1 mutations
17922009 Oncogenic NPM1-ALK contains the NPM1 oligomerization motif plus ALK catalytic domain and mediates malignant cell transformation by epigenetic silencing of signal transducer and activator of transcription STAT5A in T-cell anaplastic large cell lymphomas.
17879352 crystal structure of human NPM-core (Met9-Asp122)
17877154 NPM1 exon 12 mutations occur with a considerable percentage in AML patients with normal karyotype, and are associated with higher peripheral white cell count and lower expression of CD34 and CD117.
17875528 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17875528 NPM1 mutations were significantly associated with old age, high peripheral white blood cell count, and the subtypes of French-American-British categories M1/M5, but negatively associated with expression of CD34 and CD117 in a Chinese population.
17768124 NPM1 mutations are associated with residual disease of acute myeloid leukemia
17715399 This study provides evidence for a novel role for NPM as a negative regulator of CXCR4 signaling induced by CXCL12 that may be relevant to the biology of acute myelogenous leukemia.
17690700 mutated NPM peptides can be presented by HLA molecules, suggesting that AML cells carrying cytoplasmic mutated NPM could induce an anti-leukaemic T-cell response
17690253 JunB is a critical target of mTOR and is translationally regulated in NPM-ALK-positive lymphomas.
17639390 Sustained expression of nucleophosmin (NPM1) mutation at late relapse presenting as isolated myeloid sarcoma in a patient with acute myeloid leukemia.
17637816 NPM1 mutations in acute myeloid leukemia act to achieve maximum nuclear export and cytoplasmic accumulation of NPM1
17637812 NPM1 mutations is associated with absence of nucleophosmin leukemic mutants in B and T cells from AML
17616680 COOH-terminal nuclear export signals of different strength ensure cytoplasmic accumulation of nucleophosmin leukemic mutants
17602943 B23 functions as a chaperone in the viral chromatin assembly process in infected cells.
17598835 nucleophosmin 1 mutations may cause cells to develop along the myelomonocytic lineage
17597811 mutated NPM1 leads to dysregulated HOX expression via a different mechanism than MLL rearrangement
17569113 Nuclear matrix proteins such as mutant Pyst1 and nucleophosmin 1 were downregulated, whereas eIF6 and beta-tubulin were upregulated during cell differentiation in hepatocarcinoma cells.
17549383 PAI-1 downregulates B23 in LnCAP prostatic cancer.
17546053 The leukemia-associated NPMc+ is an in vitro oncogene under the appropriate genetic context
17537995 identify splicing factor as a novel NPM/anaplastic lymphoma kinase-binding protein and substrate
17535915 B23 sumoylation regulates its subcellular localization, cell proliferation, and survival activities.
17504301 data indicate that NPM1 exon 12 is mutated in acute myelogenous leukemias but not in other common human cancers, and suggest that the NPM1 mutation may not play a role in the tumorigenesis of common solid cancers
17488663 Review. NPM1 is translocated or mutated in various lymphomas & leukemias, forming fusion proteins or NPM mutant products. The structural, functional, biological, clinical & pathological features of normal & mutant NPM1 & its malignancies are reviewed.
17440048 Frameshift mutations in exon 12 of the nucleophosmin gene (NPM1) result in aberrant cytoplasmic localization of the NPM protein (NPMc(+); NPMc(+) is relatively rare in childhood AML, particularly in younger children
17318229 This study unveils a hitherto unrecognized transcriptional corepressor function of the NPM protein, and highlights a novel mechanism by which NPM regulates cell growth and differentiation.
17315018 study could not find any NPM gene mutations in pediatric acute myeloid leukemia with normal karyotype
17306368 NPM1 exon 12 mutations is associated with acute myeloid leukemia
17277230 A novel mechanism of nucleophosmin (NPM) tumorigenesis establishes NPM as a crucial inhibitor of oncogene-induced apoptosis and senescence.
17151698 In pediatric patients, NPM1 mutations are less common than in adults and tend to affect older patients.
17147251 A new type of NPM mutation was found, and NPM mutations in MDS patients were demonstrated foe the first time. The results provides new hints for NPM gene mutations in the pathogenesis of AML and MDS.
17076533 NPM1 gene mutations cause a frame shift in the C-terminus of exon 12, disrupting the NPM nucleolar-localization signal or generating a leucine-rich nuclear export motif, resulting in abnormal cytoplasmic accumulation of NPM.
16926303 Often mutation in acute myeloid leukemia.
16912078 These results provide evidence that phosphorylation at specific sites reduces the affinity of B23 for nucleolar components and might be a factor in regulating its location during the cell cycle.
16870548 Ddetermination of mutations and promoter methylation status of NPM1 using pyrosequencing in 199 samples of myeloid neoplasia including myeloproliferative disorders (MPD).
16857742 Ras and c-Myc play important roles in the up-regulation of nucleophosmin/B23 during proliferation of cells associated with a high degree of malignancy, thus outlining a signaling cascade involving these factors in the cancer cells.
16855788 While complex formation between ARF and NPM retains ARF in the nucleolus and prevents ARF from activating p53, DNA damaging treatments promote a transient subnuclear redistribution of ARF to the nucleoplasm, where promotes p53 activation.
16835382 AUF1 was phosphorylated by ALK in vitro and was hyperphosphorylated in NPM-ALK-expressing cells.
16825495 Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.
16766651 NPM/ALK-carrying T cell lymphoma (ALK+TCL) cells secrete IL-10 and TGF-beta and express FoxP3, indicating their T regulatory (Treg) cell phenotype.
16725311 These results demonstrate a novel mechanism for transcriptional regulation of E2F1 and identify the functional role of nucleophosmin/B23 in modulating the binding of NF-kappaB, E2F1 and pRB to activate E2F1 promoter.
16720834 new exon-12 NPM mutations in acute myeloid leukemia
16709933 constitutive expression of C/EBPbeta in ALK-positive anaplastic large cell lymphoma and its relationship to NPM-ALK
16679321 the functional integrity of the B23 core motif is required for stability, efficient nucleolar localization as well as ARF binding
16678898 NPM1 mutations may be also involved in the pathogenesis of myelodysplastic syndromes.
16645213 Observational study of genetic testing. (HuGE Navigator)
16547420 results suggest that B23 plays an important role in the intracellular localization of the core protein and replication of Japanese encephalitis virus
16541144 The sensitive RQ-PCR assays for NPM1 mutations can now monitor and quantify MRD in AML patients with normal karyotype and NPM1 gene mutations.
16455956 Observational study of gene-disease association. (HuGE Navigator)
16455956 NPM1 mutations represent a common genetic abnormality in adult acute myeloid leukemia and appears to identify patients with improved response toward treatment.
16455950 both alterations are crucial for acute myeloid leukemia NPM mutant export from nucleus to cytoplasm; NPM leukemic mutants in turn recruit the wild-type NPM from nucleoli to nucleoplasm and cytoplasm
16415342 FRGY2a and YB1 disassemble nucleoli by sequestering B23, which is associated with pre-ribosomes and other structurally important nucleolar components
16376875 These findings indicate the involvement of nucleophosmin in the regulation of pre-mRNA processing, and its activity is controlled by CDK2-mediated phosphorylation on Thr(199).
16354571 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
16205118 Enforced expression of an NPM cytoplasmic mutant acutely attenuates p53-dependent and -independent functions of Arf tumor suppressor protein, and also affects endogenous NPM localization.
16170350 results indicate that HCV core can recruit B23 and p300 to relieve the repression effect of YY1 on B23 promoter activity
16076867 Observational study of genotype prevalence. (HuGE Navigator)
16046528 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16041368 Nucleophosmin (NPM) may be a Ran-Crm1 substrate that controls centrosome duplication.
15994285 the NPM1 mutation is not necessarily an early event during leukemogenesis; the NPM1 mutation was a favorable factor for achieving complete remission but was associated with a high relapse rate
15973451 Observational study of genetic testing. (HuGE Navigator)
15964625 NPM inhibits ionizing irradiation-induced p53 transactivation, and interacts with p53 in hematopoietic cells.
15872011 polyamine depletion increased expression of the NPM gene and enhances NPM nuclear translocation and increased NPM interacts with and stabilizes p53, leading to inhibition of IEC-6 cell proliferation
15870172 Observational study of genotype prevalence. (HuGE Navigator)
15870172 base sequences are given for NPM1 mutated childhood AML patients; consistent deletion/insertion features are presented
15831697 The molecular signature of cytoplasmic NPM+ AML includes up-regulation of several genes putatively involved in the maintenance of a stem-cell phenotype, suggesting that cytoplasmic NPM+ AML may derive from a multipotent hematopoietic progenitor.
15684379 NPM inhibits ARF's p53-dependent activity by targeting it to nucleoli and impairing ARF-Mdm2 association.
15665273 CDK2-BRCA1-NPM pathway coordinately functions in cell growth and tumor progression pathways.
15659725 Cytoplasmic NPM is a characteristic feature of a large subgroup of patients with AML who have a normal karyotype, NPM gene mutations, and responsiveness to induction chemotherapy.
15644315 a novel association of B23 and Gadd45a and implicate B23 as an important regulator in Gadd45a nuclear import.
15589822 c-Myc-mediated expression of NPM decreases during retinoic acid-induced differentiation of HL-60 cells.
15514966 Aloe-emodin caused increase in the amount of proform and fragment of nucleophosmin in cytoplasm may be one of the important events for aloe-emodin-induced H460 cell apoptosis pf mpm-small cell lung cancer.
15310764 NPM inhibits hypoxia-induced p53 phosphorylation at Ser-15 and interacts with p53 in hypoxic cells; hypoxia-driven cancer progression may require increased expression of NPM to suppress p53 activation and maintain cell survival
15190079 identification of Ser-4 in B23 as a major physiological substrate of Polo-like kinase 1
15184379 BRCA1-BARD1 catalyzes the polyubiquitination of nucleolar phosphoprotein nucleophosmin/B23
15087454 nucleophosmin is an NF-kappaB co-activator for the induction of the human SOD2 gene
15082766 These data suggest that nucleophosmin is an early responder to DNA damage that prevents premature activation of p53.
14730621 cleavage of B23 by granzyme b in intact vascular smooth muscle cells is dependent upon both cell type and phenotype
14656879 NPM/ALK-mediated induction of Bcl-XL
14636574 Results reveal a molecular mechanism of ARF in regulating ribosome biogenesis and cell proliferation via inhibiting B23.
14563642 Src-kinases, particularly pp60(c-src), associate with and are activated by NPM-ALK expression in various cells, and in cell lines established from patients with large cell lymphoma
14519847 unique B23 conformation in hepatoma
14506644 These findings suggest that an NPM/MLF1 fusion is the primary molecular abnormality in t(3;5) MDS and AML with multilineage dysplasia, and that cases with NPM/MLF1 may be clinically distinct from other MDS-associated disease
12882984 overexpression of NPM suppressed PKR activity, enhanced protein synthesis, and inhibited apoptosis. Fanconi anemia lymphoblasts expressed low levels of NPM, which correlated with high ground-state activation of PKR and hypersensitivity to apoptotic cues
12511551 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
12374805 involvement of NPM/B23 in the acute response of mammalian cells to environmental stress, such as UV rays
12080348 NPM is a crucial regulator of p53
12057857 marker of proliferation activity of human peripheral lymphocytes
12031912 overexpressed in acute myeloid leukemia while translocations associated with this gene are absent
9150888 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
9094689 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
9092824 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
8224012 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
7826206 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
7794916 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
7628555 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
7593322 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
2404140 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
2109912 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
2017166 Nucleophosmin (NPM1, nucleolar phosphoprotein B23, numatrin) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS      1 - 70
PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG     71 - 140
KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQN    141 - 210
GKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD    211 - 280
QEAIQDLWQWRKSL                                                            281 - 294
//

Text Mined References (573)

PMID Year Title
26894557 2016 Simultaneous detection of mutations and copy number variation of NPM1 in the acute myeloid leukemia using multiplex ligation-dependent probe amplification.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26847745 2016 The value of molecular stratification for CEBPA(DM) and NPM1(MUT) FLT3(WT) genotypes in older patients with acute myeloid leukaemia.
26789727 2016 Assessment of Minimal Residual Disease in Standard-Risk AML.
26666953 2016 NPM1 Mutation Detection in Acute Myeloid Leukemia: A Method Comparison Study.
26642792 2015 Expression of B23/Nucleophosphamine Nonribosomal Nucleolar Protein in Smooth Muscle Tumors of the Corpus Uteri.
26559910 2015 NPM1 histone chaperone is upregulated in glioblastoma to promote cell survival and maintain nucleolar shape.
26536659 2015 Phosphorylation of nucleophosmin at threonine 234/237 is associated with HCC metastasis.
26343305 2015 Upregulation of B23 promotes tumor cell proliferation and predicts poor prognosis in glioma.
26231209 2015 C1q protein binds to the apoptotic nucleolus and causes C1 protease degradation of nucleolar proteins.
26205693 2015 Novel structural co-expression analysis linking the NPM1-associated ribosomal biogenesis network to chronic myelogenous leukemia.
26123729 2015 Cytoplasmic nucleophosmin has elevated T199 phosphorylation upon which G2/M phase progression is dependent.
26113416 2015 NPM1 mutation is associated with leukemia cutis in acute myeloid leukemia with monocytic features.
26101160 2015 Multilineage dysplasia as assessed by immunophenotype has no impact on clinical-biological features and outcome of NPM1-mutated acute myeloid leukemia.
26068981 2015 NPM1 activates metabolic changes by inhibiting FBP1 while promoting the tumorigenicity of pancreatic cancer cells.
26055329 2015 TRIM28 Is an E3 Ligase for ARF-Mediated NPM1/B23 SUMOylation That Represses Centrosome Amplification.
25992555 2015 Altered HLA Class I Profile Associated with Type A/D Nucleophosmin Mutation Points to Possible Anti-Nucleophosmin Immune Response in Acute Myeloid Leukemia.
25977257 2015 Nucleophosmin contains amyloidogenic regions that are able to form toxic aggregates under physiological conditions.
25961029 2015 Coexpression Pattern Analysis of NPM1-Associated Genes in Chronic Myelogenous Leukemia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918010 2015 The HBx oncoprotein of hepatitis B virus engages nucleophosmin to promote rDNA transcription and cellular proliferation.
25908633 2015 Insights into the regulation of neuronal viability by nucleophosmin/B23.
25907517 2015 Nucleophosmin overexpression is associated with poor survival in astrocytoma.
25818168 2015 GLTSCR2 is an upstream negative regulator of nucleophosmin in cervical cancer.
25809997 2016 Chronic myelomonocytic leukemia with nucleophosmin (NPM1) mutation.
25805179 2015 Pharmacologic inhibition of the CK2-mediated phosphorylation of B23/NPM in cancer cells selectively modulates genes related to protein synthesis, energetic metabolism, and ribosomal biogenesis.
25791120 2015 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NF?B and JNK.
25779376 2015 The cytological features of NPM1-mutated acute myeloid leukemia.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25754892 2015 The nucleolar protein nucleophosmin is essential for autophagy induced by inhibiting Pol I transcription.
25749034 2015 NPM/ALK mutants resistant to ASP3026 display variable sensitivity to alternative ALK inhibitors but succumb to the novel compound PF-06463922.
25713434 2015 Prognostic significance of NPM1 mutations in the absence of FLT3-internal tandem duplication in older patients with acute myeloid leukemia: a SWOG and UK National Cancer Research Institute/Medical Research Council report.
25711412 2015 A novel mechanism of post-translational modulation of HMGA functions by the histone chaperone nucleophosmin.
25648021 2014 NPM1 gene mutation in Egyptian patients with cytogenetically normal acute myeloid leukemia.
25543261 2015 miR-21 is overexpressed in NPM1-mutant acute myeloid leukemias.
25527567 2015 Correlation between peripheral blood and bone marrow regarding FLT3-ITD and NPM1 mutational status in patients with acute myeloid leukemia.
25468431 2015 A clinical grade sequencing-based assay for CEBPA mutation testing: report of a large series of myeloid neoplasms.
25457413 2015 Decreased expression of nucleophosmin/B23 increases drug sensitivity of adriamycin-resistant Molt-4 leukemia cells through mdr-1 regulation and Akt/mTOR signaling.
25421715 2014 Identification of novel DNA-damage tolerance genes reveals regulation of translesion DNA synthesis by nucleophosmin.
25416956 2014 A proteome-scale map of the human interactome network.
25400766 2014 Double CEBPA mutations are prognostically favorable in non-M3 acute myeloid leukemia patients with wild-type NPM1 and FLT3-ITD.
25389240 2015 Significance of IMP3, nucleophosmin, and Ki-67 expression in papillary thyroid carcinoma.
25384962 2015 Mutant Enrichment with 3'-Modified Oligonucleotides (MEMO)-Quantitative PCR for Detection of NPM1 Mutations in Acute Myeloid Leukemia.
25381129 2015 Characterization of gene mutations and copy number changes in acute myeloid leukemia using a rapid target enrichment protocol.
25349213 2014 Loss of nucleolar histone chaperone NPM1 triggers rearrangement of heterochromatin and synergizes with a deficiency in DNA methyltransferase DNMT3A to drive ribosomal DNA transcription.
25349176 2014 A novel recurrent NPM1-TYK2 gene fusion in cutaneous CD30-positive lymphoproliferative disorders.
25348016 2014 Nontoxic-dose of deguelin induce NPMc+ AML cell differentiation by selectively targeting Mt NPM1/SIRT1 instead of HDAC1/3.
25299584 2014 The NPM1 mutation type has no impact on survival in cytogenetically normal AML.
25288641 2014 mTOR signaling regulates nucleolar targeting of the SUMO-specific isopeptidase SENP3.
25281355 2014 Clinical features of de novo acute myeloid leukemia with concurrent DNMT3A, FLT3 and NPM1 mutations.
25242579 2015 Deguelin, a selective silencer of the NPM1 mutant, potentiates apoptosis and induces differentiation in AML cells carrying the NPM1 mutation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25083817 2014 High DNA-methyltransferase 3B expression predicts poor outcome in acute myeloid leukemia, especially among patients with co-occurring NPM1 and FLT3 mutations.
25079101 2014 Translational implications of somatic genomics in acute myeloid leukaemia.
25039748 2014 Quantification of rare NPM1 mutation subtypes by digital PCR.
25033841 2014 Extrinsic apoptosis is impeded by direct binding of the APL fusion protein NPM-RAR to TRADD.
25026287 2014 MRD assessed by WT1 and NPM1 transcript levels identifies distinct outcomes in AML patients and is influenced by gemtuzumab ozogamicin.
24991885 2014 Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells.
24895580 2014 Mutation analysis of JAK2V617F, FLT3-ITD, NPM1, and DNMT3A in Chinese patients with myeloproliferative neoplasms.
24859829 2014 TET2 gene mutation is unfavorable prognostic factor in cytogenetically normal acute myeloid leukemia patients with NPM1+ and FLT3-ITD - mutations.
24857377 2014 Phosphorylation of multifunctional nucleolar protein nucleophosmin (NPM1) by aurora kinase B is critical for mitotic progression.
24816240 2014 Molecular response assessment by quantitative real-time polymerase chain reaction after induction therapy in NPM1-mutated patients identifies those at high risk of relapse.
24801015 2014 Prognostic significance of FLT3 internal tandem duplication, nucleophosmin 1, and CEBPA gene mutations for acute myeloid leukemia patients with normal karyotype and younger than 60 years: a systematic review and meta-analysis.
24796332 2014 NPM1 silencing reduces tumour growth and MAPK signalling in prostate cancer cells.
24793791 2015 Phosphorylated STAT3 physically interacts with NPM and transcriptionally enhances its expression in cancer.
24787960 2014 Regulatory role of nucleophosmin during the differentiation of human liver cancer cells.
24743218 2014 Detection of minimal residual disease in NPM1-mutated acute myeloid leukemia by next-generation sequencing.
24724782 2015 Acute myeloid leukemia in patients older than 75: prognostic impact of FLT3-ITD and NPM1 mutations.
24716928 2014 Prognostic role of nucleophosmin in colorectal carcinomas.
24666762 2014 Lower frequency of NPM1 and FLT3-ITD mutations in a South African adult de novo AML cohort.
24616519 2014 Structural polymorphism in the N-terminal oligomerization domain of NPM1.
24596420 2014 Implications of the miR-10 family in chemotherapy response of NPM1-mutated AML.
24576674 2014 G-quadruplex DNA recognition by nucleophosmin: new insights from protein dissection.
24573385 2014 The prognostic relevance of flt3 and npm1 mutations on older patients treated intensively or non-intensively: a study of 1312 patients in the UK NCRI AML16 trial.
24515769 2014 Expression and prognostic significance of APE1/Ref-1 and NPM1 proteins in high-grade ovarian serous cancer.
24462683 2014 Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly.
24443894 2014 IDH1 and IDH2 mutations confer an adverse effect in patients with acute myeloid leukemia lacking the NPM1 mutation.
24413856 A surrogate marker to detect nucleophosnim (NPM1) gene mutations in the cytoplasm of acute myeloid leukemia (AML) blast cells in 30 adult Iraqi patients.
24289551 2013 Prognostic involvement of nucleophosmin mutations in acute myeloid leaukemia.
24288427 2013 Mutation of NPM1 and FLT3 genes in acute myeloid leukemia and their association with clinical and immunophenotypic features.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24220271 2014 Recurrent mutations, including NPM1c, activate a BRD4-dependent core transcriptional program in acute myeloid leukemia.
24192815 2014 The surface molecular signature of leukemic cells is associated with NPM1 mutations and FLT3 -ITD in patients with de novo acute myeloid leukemia.
24183235 2013 Interaction with RXR is necessary for NPM-RAR-induced myeloid differentiation blockade.
24164801 2014 NPM1, FLT3-ITD, CEBPA, and c-kit mutations in 312 Chinese patients with de novo acute myeloid leukemia.
24097631 2014 Intensive induction is effective in selected octogenarian acute myeloid leukemia patients: prognostic significance of karyotype and selected molecular markers used in the European LeukemiaNet classification.
24035716 2013 CXC chemokine receptor 4 expression, CXC chemokine receptor 4 activation, and wild-type nucleophosmin are independently associated with unfavorable prognosis in patients with acute myeloid leukemia.
24004182 2014 Mutated NPM1 in patients with acute myeloid leukemia in remission and relapse.
23998253 2014 Novel NPM1 mutation in the 3'-untranslated region identified in two patients with acute myeloid leukemia.
23929838 2013 Immune responses against the mutated region of cytoplasmatic NPM1 might contribute to the favorable clinical outcome of AML patients with NPM1 mutations (NPM1mut).
23927396 2014 NPM-RAR, not the RAR-NPM reciprocal t(5;17)(q35;q21) acute promyelocytic leukemia fusion protein, inhibits myeloid differentiation.
23907410 2014 A fast and simple approach for the simultaneous detection of hematopoietic chimerism, NPM1, and FLT3-ITD mutations after allogeneic stem cell transplantation.
23892143 2013 Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells.
23877794 2013 Role of cysteine 288 in nucleophosmin cytoplasmic mutations: sensitization to toxicity induced by arsenic trioxide and bortezomib.
23874639 2013 Nucleophosmin1 is a negative regulator of the small GTPase Rac1.
23831574 2014 Functional regulation of the apurinic/apyrimidinic endonuclease 1 by nucleophosmin: impact on tumor biology.
23814019 2013 Integrated phosphoproteomic and metabolomic profiling reveals NPM-ALK-mediated phosphorylation of PKM2 and metabolic reprogramming in anaplastic large cell lymphoma.
23763915 2013 Effect of NPM1 and FLT3 mutations on the outcomes of elderly patients with acute myeloid leukemia receiving standard chemotherapy.
23753029 2013 In rare acute myeloid leukemia patients harboring both RUNX1 and NPM1 mutations, RUNX1 mutations are unusual in structure and present in the germline.
23742937 2013 Recognition of intermolecular G-quadruplexes by full length nucleophosmin. Effect of a leukaemia-associated mutation.
23730215 2013 Molecular and functional characterizations of the association and interactions between nucleophosmin-anaplastic lymphoma kinase and type I insulin-like growth factor receptor.
23716555 2013 A single center analysis of nucleophosmin in acute myeloid leukemia: value of combining immunohistochemistry with molecular mutation analysis.
23704090 2013 Clonal evolution in relapsed NPM1-mutated acute myeloid leukemia.
23666693 2013 Molecular genetic tests for FLT3, NPM1, and CEBPA in acute myeloid leukemia.
23656730 2013 The level of residual disease based on mutant NPM1 is an independent prognostic factor for relapse and survival in AML.
23618861 2013 The folding pathway of a functionally competent C-terminal domain of nucleophosmin: protein stability and denatured state residual structure.
23601747 2013 NPM1-mutated acute myeloid leukemia of monocytic or myeloid origin exhibit distinct immunophenotypes.
23591014 2013 Cytoplasmic expression of nucleophosmin 1 as a marker for diagnosing residual disease of acute myeloid leukemia.
23590662 2013 Acute myeloid leukemia: advances in diagnosis and classification.
23544830 2013 Role of the unstructured N-terminal domain of the hAPE1 (human apurinic/apyrimidinic endonuclease 1) in the modulation of its interaction with nucleic acids and NPM1 (nucleophosmin).
23540998 2014 Prognostic implications of NPM1 mutations and FLT3 internal tandem duplications in Egyptian patients with cytogenetically normal acute myeloid leukemia.
23536448 2013 Nucleophosmin 1, upregulated in adenomas and cancers of the colon, inhibits p53-mediated cellular senescence.
23511494 2013 NPM1, FLT3, and c-KIT mutations in pediatric acute myeloid leukemia in Russian population.
23496932 2013 Hierarchical cluster analysis of immunophenotype classify AML patients with NPM1 gene mutation into two groups with distinct prognosis.
23489260 2013 Clinical significance of nucleophosmin/B23 and human epidermal growth factor receptor 2/neu expressions in gastric cancers.
23483572 2013 Interactomic approach for evaluating nucleophosmin-binding proteins as biomarkers for Ewing's sarcoma.
23436734 2013 Nucleophosmin mutations in acute myeloid leukemia: a tale of protein unfolding and mislocalization.
23435463 2013 The human NPM1 mutation A perturbs megakaryopoiesis in a conditional mouse model.
23403313 2013 Acute myeloid leukemia with translocation t(3;5): new molecular insights.
23393136 2013 Mutations in the nucleolar phosphoprotein, nucleophosmin, promote the expression of the oncogenic transcription factor MEF/ELF4 in leukemia cells and potentiates transformation.
23377436 2013 Favorable outcome of patients with acute myeloid leukemia harboring a low-allelic burden FLT3-ITD mutation and concomitant NPM1 mutation: relevance to post-remission therapy.
23338972 2013 NPM-ALK up-regulates iNOS expression through a STAT3/microRNA-26a-dependent mechanism.
23328624 2013 Nucleophosmin mutations alter its nucleolar localization by impairing G-quadruplex binding at ribosomal DNA.
23301224 2013 Identification of two novel NPM1 mutations in patients with acute myeloid leukemia.
23285058 2012 Elucidation of motifs in ribosomal protein S9 that mediate its nucleolar localization and binding to NPM1/nucleophosmin.
23271972 2012 The nuclear chaperone nucleophosmin escorts an Epstein-Barr Virus nuclear antigen to establish transcriptional cascades for latent infection in human B cells.
23238897 2013 Association of cup-like nuclei in blasts with FLT3 and NPM1 mutations in acute myeloid leukemia.
23232117 2013 Role of mutual interactions in the chemical and thermal stability of nucleophosmin NPM1 domains.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23183427 2013 Nucleophosmin/B26 regulates PTEN through interaction with HAUSP in acute myeloid leukemia.
23154527 2013 Refining the diagnosis and prognostic categorization of acute myeloid leukemia patients with an integrated use of cytogenetic and molecular studies.
23065518 2013 A polymorphism in the 3'-untranslated region of the NPM1 gene causes illegitimate regulation by microRNA-337-5p and correlates with adverse outcome in acute myeloid leukemia.
23064464 2012 PDGFR blockade is a rational and effective therapy for NPM-ALK-driven lymphomas.
23020761 2013 Clonal heterogeneity in patients with cytogenetically normal acute myeloid leukemia with NPM1 mutations.
23019224 2012 DDX31 regulates the p53-HDM2 pathway and rRNA gene transcription through its interaction with NPM1 in renal cell carcinomas.
22996295 2013 Whole-genome-amplified DNA as a source for mutational analysis underestimates the frequency of mutations in pediatric acute myeloid leukemia.
22968966 2012 Detection of cytoplasmic nucleophosmin expression by imaging flow cytometry.
22926011 2013 Estrogen stimulates the proliferation of human endometrial cancer cells by stabilizing nucleophosmin/B23 (NPM/B23).
22914610 2013 CD123 immunohistochemical expression in acute myeloid leukemia is associated with underlying FLT3-ITD and NPM1 mutations.
22911473 2012 Role of autologous hematopoietic stem cell transplantation according to the NPM1/FLT3-ITD molecular status for cytogenetically normal AML patients: a GOELAMS study.
22906848 2012 Prognostic impact of NPM1 mutations in Serbian adult patients with acute myeloid leukemia.
22851180 2012 Up-regulation of translation eukaryotic initiation factor 4E in nucleophosmin 1 haploinsufficient cells results in changes in CCAAT enhancer-binding protein ? activity: implications in myelodysplastic syndrome and acute myeloid leukemia.
22791379 2013 NPM1 mutations occur rarely or not at all in chronic myeloid leukaemia patients in chronic phase or blast crisis.
22761710 2012 A phthalimide derivative that inhibits centrosomal clustering is effective on multiple myeloma.
22745010 2012 Quantitative proteomic analysis and functional studies reveal that nucleophosmin is involved in cell death in glioblastoma cell line transfected with siRNA.
22733614 2012 FLT3 and NPM1 mutations in a cohort of AML patients and detection of a novel mutation in tyrosine kinase domain of FLT3 gene from Western India.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22717133 2012 Adenoviral protein V promotes a process of viral assembly through nucleophosmin 1.
22712502 2012 Erythroid differentiation-associated gene interacts with NPM1 (nucleophosmin/B23) and increases its protein stability, resisting cell apoptosis.
22707729 2012 Structure of nucleophosmin DNA-binding domain and analysis of its complex with a G-quadruplex sequence from the c-MYC promoter.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22665062 2013 Nucleophosmin is essential for c-Myc nucleolar localization and c-Myc-mediated rDNA transcription.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22631075 2012 Expression of nucleophosmin/NPM1 correlates with migration and invasiveness of colon cancer cells.
22592607 2012 Mutated regions of nucleophosmin 1 elicit both CD4(+) and CD8(+) T-cell responses in patients with acute myeloid leukemia.
22573554 2012 In silico studies of potential phosphoresidues in the human nucleophosmin/B23: its kinases and related biological processes.
22528486 2012 Nucleophosmin (NPM1/B23) interacts with activating transcription factor 5 (ATF5) protein and promotes proteasome- and caspase-dependent ATF5 degradation in hepatocellular carcinoma cells.
22510990 2012 AKT-dependent phosphorylation of Niban regulates nucleophosmin- and MDM2-mediated p53 stability and cell apoptosis.
22494415 2012 IDH2 mutations are frequent in Chinese patients with acute myeloid leukemia and associated with NPM1 mutations and FAB-M2 subtype.
22487825 2012 [Establishment of a rapid and easy method for simultaneous detection of FLT3-ITD and NPM1 gene mutations in acute myeloid leukemia].
22481022 2012 Detection of CD34, TdT, CD56, CD2, CD4, and CD14 by flow cytometry is associated with NPM1 and FLT3 mutation status in cytogenetically normal acute myeloid leukemia.
22475129 2012 Nucleophosmin gene-based monitoring in de novo cytogenetically normal acute myeloid leukemia with nucleophosmin gene mutations: comparison with cytofluorimetric analysis and study of Wilms tumor gene 1 expression.
22467873 2012 G protein-coupled receptor kinase 5 phosphorylates nucleophosmin and regulates cell sensitivity to polo-like kinase 1 inhibition.
22454318 2012 Next-generation sequencing for minimal residual disease monitoring in acute myeloid leukemia patients with FLT3-ITD or NPM1 mutations.
22451695 2012 Nucleophosmin/B23 activates Aurora A at the centrosome through phosphorylation of serine 89.
22397365 2012 Molecular alterations of isocitrate dehydrogenase 1 and 2 (IDH1 and IDH2) metabolic genes and additional genetic mutations in newly diagnosed acute myeloid leukemia patients.
22374696 2012 The FLT3ITD mRNA level has a high prognostic impact in NPM1 mutated, but not in NPM1 unmutated, AML with a normal karyotype.
22362753 2012 Function of homo- and hetero-oligomers of human nucleoplasmin/nucleophosmin family proteins NPM1, NPM2 and NPM3 during sperm chromatin remodeling.
22362118 2012 Monoallelic CEBPA mutations in normal karyotype acute myeloid leukemia: independent favorable prognostic factor within NPM1 mutated patients.
22337638 2012 B23/nucleophosmin is involved in regulation of adenovirus chromatin structure at late infection stages, but not in virus replication and transcription.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22193965 2012 NPM-MLF1 synergizes with Npm haploinsufficiency to enhance myeloid progenitor activity.
22174271 2012 Cryptic disorder: an order-disorder transformation regulates the function of nucleophosmin.
22126574 2011 FLT3 and NPM1 gene mutations in childhood acute myeloblastic leukemia.
22104247 2012 Clinical implications of non-A-type NPM1 and FLT3 mutations in patients with normal karyotype acute myeloid leukemia.
22099964 2011 Novel mutations of the nucleophosmin (NPM-1) gene in Egyptian patients with acute myeloid leukemia: a pilot study.
22002061 2011 New centromeric component CENP-W is an RNA-associated nuclear matrix protein that interacts with nucleophosmin/B23 protein.
21986840 2012 Downregulation of MEIS1 impairs long-term expansion of CD34+ NPM1-mutated acute myeloid leukemia cells.
21979956 2011 Nucleophosmin interacts with FOXM1 and modulates the level and localization of FOXM1 in human cancer cells.
21933585 2011 Expression of nucleophosmin in glandular epithelium of non-pregnant human endometrium during the menstrual cycle.
21904378 2012 The surface molecule signature of primary human acute myeloid leukemia (AML) cells is highly associated with NPM1 mutation status.
21880628 2011 Integrative nucleophosmin mutation-associated microRNA and gene expression pattern analysis identifies novel microRNA - target gene interactions in acute myeloid leukemia.
21860418 2012 Correlation analysis of p53 protein isoforms with NPM1/FLT3 mutations and therapy response in acute myeloid leukemia.
21822216 2011 Nucleophosmin deposition during mRNA 3' end processing influences poly(A) tail length.
21809990 2011 Detection of nucleophosmin 1 mutations by quantitative real-time polymerase chain reaction versus capillary electrophoresis: a comparative study.
21789382 2011 Screening for hotspot mutations in PI3K, JAK2, FLT3 and NPM1 in patients with myelodysplastic syndromes.
21784052 2011 miR-10a overexpression is associated with NPM1 mutations and MDM4 downregulation in intermediate-risk acute myeloid leukemia.
21765024 2011 Oncogenic tyrosine kinase NPM-ALK induces expression of the growth-promoting receptor ICOS.
21763502 2011 HIV-1 infection induces acetylation of NPM1 that facilitates Tat localization and enhances viral transactivation.
21744003 2012 Age-dependent frequencies of NPM1 mutations and FLT3-ITD in patients with normal karyotype AML (NK-AML).
21719597 2011 Targeting levels or oligomerization of nucleophosmin 1 induces differentiation and loss of survival of human AML cells with mutant NPM1.
21705779 2011 Autoregulatory circuit of human rpL3 expression requires hnRNP H1, NPM and KHSRP.
21703420 2011 Fusion tyrosine kinase NPM-ALK Deregulates MSH2 and suppresses DNA mismatch repair function novel insights into a potent oncoprotein.
21689627 2011 An extensive tumor array analysis supports tumor suppressive role for nucleophosmin in breast cancer.
21666141 2011 Locked nucleic acid probes for enhanced detection of FLT3 D835/I836, JAK2 V617F and NPM1 mutations.
21660047 2011 Nucleolar NF-?B/RelA mediates apoptosis by causing cytoplasmic relocalization of nucleophosmin.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21621842 2012 Amount of bone marrow blasts is strongly correlated to NPM1 and FLT3-ITD mutation rate in AML with normal karyotype.
21606167 2011 Prognostic impact of white blood cell count in intermediate risk acute myeloid leukemia: relevance of mutated NPM1 and FLT3-ITD.
21577323 2011 Trisomy 11 as an isolated abnormality in acute myeloid leukemia is associated with unfavorable prognosis but not with an NPM1 or KIT mutation.
21555683 2011 Monitoring of minimal residual disease in NPM1-mutated acute myeloid leukemia: a study from the German-Austrian acute myeloid leukemia study group.
21537492 2011 Knockdown of NPM1 by RNA interference inhibits cells proliferation and induces apoptosis in leukemic cell line.
21537333 2011 Prognostic impact of FLT3-ITD load in NPM1 mutated acute myeloid leukemia.
21518927 2011 The lymphoma-associated NPM-ALK oncogene elicits a p16INK4a/pRb-dependent tumor-suppressive pathway.
21516736 2010 [FLT3 and NPM1 gene mutations in patients with acute myeloid leukemias and the impact of FLT3-ITD mutations on the survival of patients with a normal karyotype].
21492127 2011 Marked down-regulation of nucleophosmin-1 is associated with advanced del(5q) myelodysplastic syndrome.
21441929 2011 Mutant nucleophosmin and cooperating pathways drive leukemia initiation and progression in mice.
21425800 2011 The multifunctional protein nucleophosmin (NPM1) is a human linker histone H1 chaperone.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21418451 2011 The importin-alpha/nucleophosmin switch controls taspase1 protease function.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21393327 2011 NPM1 gene deletions in myelodysplastic syndromes with 5q- and complex karyotype.
21338238 2010 Fms like tyrosine kinase (FLT3) and nucleophosmin 1 (NPM1) mutations in de novo normal karyotype acute myeloid leukemia (AML).
21331074 2011 Reply to: 'Flow cytometric identification of acute myeloid leukemia with limited differentiation and NPM1 type A mutation: a new biologically defined entity' by Kern et al.
21326211 2011 The SUMO system controls nucleolar partitioning of a novel mammalian ribosome biogenesis complex.
21316727 2011 Involvement of the UL24 protein in herpes simplex virus 1-induced dispersal of B23 and in nuclear egress.
21310483 2011 DIGE-based proteomic analysis identifies nucleophosmin/B23 and nucleolin C23 as over-expressed proteins in relapsed/refractory acute leukemia.
21278791 2011 Nucleophosmin and its complex network: a possible therapeutic target in hematological diseases.
21269460 2011 Initial characterization of the human central proteome.
21258971 2011 Nucleophosmin delocalization in thyroid tumour cells.
21245599 Detection of nucleophosmin and FMS-like tyrosine kinase-3 gene mutations in acute myeloid leukemia.
21245151 2011 A multiprotein binding interface in an intrinsically disordered region of the tumor suppressor protein interferon regulatory factor-1.
21233837 2011 Characterization of NPM1-mutated AML with a history of myelodysplastic syndromes or myeloproliferative neoplasms.
21183700 2010 The prognostic value of multilineage dysplasia in de novo acute myeloid leukemia patients with intermediate-risk cytogenetics is dependent on NPM1 mutational status.
21182834 2011 Akt2 and nucleophosmin/B23 function as an oncogenic unit in human lung cancer cells.
21173125 2011 FLT3 and NPM1 mutations in myelodysplastic syndromes: Frequency and potential value for predicting progression to acute myeloid leukemia.
21122805 2011 Nucleophosmin gene mutations promote NIH3T3 cell migration and invasion through CXCR4 and MMPs.
21102525 2011 Oncogenic kinase NPM/ALK induces expression of HIF1? mRNA.
21084279 2011 BRCA2 and nucleophosmin coregulate centrosome amplification and form a complex with the Rho effector kinase ROCK2.
21045017 2011 Serine phosphorylation of NPM-ALK, which is dependent on the auto-activation of the kinase activation loop, contributes to its oncogenic potential.
21030560 2011 Acute myeloid leukemia with mutated nucleophosmin (NPM1): is it a distinct entity?
20981679 2010 Monitoring of minimal residual disease in acute myeloid leukemia with frequent and rare patient-specific NPM1 mutations.
20979630 2010 The frequency of NPM1 mutations in childhood acute myeloid leukemia.
20962268 2010 Dephosphorylation of nucleophosmin by PP1? facilitates pRB binding and consequent E2F1-dependent DNA repair.
20924036 2010 Absence of NPM1 promoter hypermethylation in human myelodysplastic syndrome.
20880116 2010 ASXL1 mutation is associated with poor prognosis and acute transformation in chronic myelomonocytic leukaemia.
20877721 2010 NPM1 deletion is associated with gross chromosomal rearrangements in leukemia.
20875872 2010 Genomic, immunophenotypic, and NPM1/FLT3 mutational studies on 17 patients with normal karyotype acute myeloid leukemia (AML) followed by aberrant karyotype AML at relapse.
20872983 2010 FLT3 and NPM1 mutations in Chinese patients with acute myeloid leukemia and normal cytogenetics.
20864535 2010 Cytoplasmic FANCA-FANCC complex interacts and stabilizes the cytoplasm-dislocalized leukemic nucleophosmin protein (NPMc).
20858903 2010 Nucleophosmin C-terminal leukemia-associated domain interacts with G-rich quadruplex forming DNA.
20855646 2010 Is the association of "cup-like" nuclei with mutation of the NPM1 gene in acute myeloid leukemia clinically useful?
20849383 2010 Minimal residual disease diagnostics in patients with acute myeloid leukemia in the post-transplant period: comparison of peripheral blood and bone marrow analysis.
20807181 2010 The role of nucleophosmin/B23 in radiation-induced chromosomal instability in human lymphoblastoid cells of different p53 genotypes.
20803351 2010 Incidence and significance of FLT3-ITD and NPM1 mutations in patients with normal karyotype acute myeloid leukaemia.
20802533 2011 Identification of FUSE-binding protein 1 as a regulatory mRNA-binding protein that represses nucleophosmin translation.
20724983 2010 Rapid flow cytometric detection of aberrant cytoplasmic localization of nucleophosmin (NPMc) indicating mutant NPM1 gene in acute myeloid leukemia.
20713529 2010 Recruitment of phosphorylated NPM1 to sites of DNA damage through RNF8-dependent ubiquitin conjugates.
20713446 2010 Regulation of nucleolar chromatin by B23/nucleophosmin jointly depends upon its RNA binding activity and transcription factor UBF.
20684989 2011 Prognostic factors in normal karyotype acute myeloid leukemia in the absence of the FLT3-ITD mutation.
20678218 2010 Combined mutations of ASXL1, CBL, FLT3, IDH1, IDH2, JAK2, KRAS, NPM1, NRAS, RUNX1, TET2 and WT1 genes in myelodysplastic syndromes and acute myeloid leukemias.
20673208 2010 State of oncomarker protein B23/nucleophosmin in HeLa cells.
20651067 2010 The prognostic significance of IDH1 mutations in younger adult patients with acute myeloid leukemia is dependent on FLT3/ITD status.
20634376 2010 CD34+ cells from AML with mutated NPM1 harbor cytoplasmic mutated nucleophosmin and generate leukemia in immunocompromised mice.
20618440 2010 Proteomic and biochemical analysis of 14-3-3-binding proteins during C2-ceramide-induced apoptosis.
20616361 2010 Performance and clinical evaluation of a sensitive multiplex assay for the rapid detection of common NPM1 mutations.
20606168 2010 Mutant nucleophosmin deregulates cell death and myeloid differentiation through excessive caspase-6 and -8 inhibition.
20592250 2010 High-frequency type I/II mutational shifts between diagnosis and relapse are associated with outcome in pediatric AML: implications for personalized medicine.
20554525 2010 Involvement of Grb2 adaptor protein in nucleophosmin-anaplastic lymphoma kinase (NPM-ALK)-mediated signaling and anaplastic large cell lymphoma growth.
20546020 2010 ETS-related gene ERG expression in AML patients is significantly associated with NPM1 mutation status.
20542566 2011 Immunophenotype of acute myeloid leukemia with NPM mutations: prognostic impact of the leukemic compartment size.
20533335 2010 Proteomic analysis of low- to high-grade astrocytomas reveals an alteration of the expression level of raf kinase inhibitor protein and nucleophosmin.
20520634 2010 Mutation analysis for RUNX1, MLL-PTD, FLT3-ITD, NPM1 and NRAS in 269 patients with MDS or secondary AML.
20515654 2010 Nucleophosmin is overexpressed in thyroid tumors.
20513120 2010 C/EBPA gene mutation and C/EBPA promoter hypermethylation in acute myeloid leukemia with normal cytogenetics.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20506166 2010 Localization of nucleophosmin in nuclear matrix and changes in its expression during the differentiation of human neuroblastoma induced by retinoic acid.
20494930 2010 IDH1 mutations in patients with myelodysplastic syndromes are associated with an unfavorable prognosis.
20471513 2010 Detection of t(3;5) and NPM1/MLF1 rearrangement in an elderly patient with acute myeloid leukemia: clinical and laboratory study with review of the literature.
20464055 2010 Nucleophosmin gene mutation in acute myeloid leukemia patients.
20439648 2010 Prognostic significance of CEBPA mutations in a large cohort of younger adult patients with acute myeloid leukemia: impact of double CEBPA mutations and the interaction with FLT3 and NPM1 mutations.
20428199 2010 Gene expression profiling in AML with normal karyotype can predict mutations for molecular markers and allows novel insights into perturbed biological pathways.
20424160 2010 The tyrosine 343 residue of nucleophosmin (NPM)-anaplastic lymphoma kinase (ALK) is important for its interaction with SHP1, a cytoplasmic tyrosine phosphatase with tumor suppressor functions.
20404347 2010 Nucleophosmin/B23 inhibits Eg5-mediated microtubule depolymerization by inactivating its ATPase activity.
20393185 2010 Studies of phosphoproteomic changes induced by nucleophosmin-anaplastic lymphoma kinase (ALK) highlight deregulation of tumor necrosis factor (TNF)/Fas/TNF-related apoptosis-induced ligand signaling pathway in ALK-positive anaplastic large cell lymphoma.
20368538 2010 Impact of IDH1 R132 mutations and an IDH1 single nucleotide polymorphism in cytogenetically normal acute myeloid leukemia: SNP rs11554137 is an adverse prognostic factor.
20368469 2010 WT1 mutation in 470 adult patients with acute myeloid leukemia: stability during disease evolution and implication of its incorporation into a survival scoring system.
20352051 2010 Polo-like kinase 2-dependent phosphorylation of NPM/B23 on serine 4 triggers centriole duplication.
20338617 2010 Nucleophosmin, p53, and Ki-67 expression patterns on an oral squamous cell carcinoma tissue microarray.
20333249 2010 Nucleophosmin phosphorylation by v-cyclin-CDK6 controls KSHV latency.
20306250 2010 Acute myeloid leukemia with mutated nucleophosmin (NPM1): molecular, pathological, and clinical features.
20237420 2010 NSP 5a3a's link to nuclear-cyto proteins B23 and hnRNP-L between normal and aberrant breast cell lines.
20212148 2010 Deciphering the folding transition state structure and denatured state properties of nucleophosmin C-terminal domain.
20203266 2010 Multilineage dysplasia has no impact on biologic, clinicopathologic, and prognostic features of AML with mutated nucleophosmin (NPM1).
20172040 2010 Favorable outcome in patients with acute myelogenous leukemia with the nucleophosmin gene mutation autografted after conditioning with high-dose continuous infusion of idarubicin and busulfan.
20159986 2010 Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis.
20145123 2010 Tumor suppressor HLJ1 binds and functionally alters nucleophosmin via activating enhancer binding protein 2alpha complex formation.
20137111 2010 [Correlation of adult AML Npm1 mutations with prognosis and its relationship with gene mutation of FLT3 and CEBPA].
20127469 2009 Hepatitis B virus core interacts with the host cell nucleolar protein, nucleophosmin 1.
20075868 2010 Nucleolar retention of a translational C/EBPalpha isoform stimulates rDNA transcription and cell size.
20073075 2010 NPM1 is overexpressed in hyperdiploid multiple myeloma due to a gain of chromosome 5 but is not delocalized to the cytoplasm.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20027629 2010 Nucleophosmin is recognized by a cytotoxic T cell line derived from a rectal carcinoma patient.
20026798 2010 Favorable prognostic impact of NPM1 mutations in older patients with cytogenetically normal de novo acute myeloid leukemia and associated gene- and microRNA-expression signatures: a Cancer and Leukemia Group B study.
20023256 2010 Cytoplasmic expression of nucleophosmin accurately predicts mutation in the nucleophosmin gene in patients with acute myeloid leukemia and normal karyotype.
20011973 2009 B23 interacts with PES1 and is involved in nucleolar localization of PES1.
20001230 2010 Genetic changes including gene copy number alterations and their relation to prognosis in childhood acute myeloid leukemia.
19965647 2010 The impact on outcome of the addition of all-trans retinoic acid to intensive chemotherapy in younger patients with nonacute promyelocytic acute myeloid leukemia: overall results and results in genotypic subgroups defined by mutations in NPM1, FLT3, and CEBPA.
19946888 2010 Defining the membrane proteome of NK cells.
19901261 2010 Strikingly different molecular relapse kinetics in NPM1c, PML-RARA, RUNX1-RUNX1T1, and CBFB-MYH11 acute myeloid leukemias.
19887368 2010 Functional characterization of the kinase activation loop in nucleophosmin (NPM)-anaplastic lymphoma kinase (ALK) using tandem affinity purification and liquid chromatography-mass spectrometry.
19865112 2010 Mutual exclusion of ASXL1 and NPM1 mutations in a series of acute myeloid leukemias.
19843866 2009 Regulation of protein Citrullination through p53/PADI4 network in DNA damage response.
19824900 2010 Novel immunophenotypic and morphologic presentation in acute myeloid leukemia (AML) with JAK2 V617F mutation.
19775300 2009 FLT3-ITD expression levels and their effect on STAT5 in AML with and without NPM mutations.
19770764 2009 Acute myeloid leukemia with mutated NPM1: diagnosis, prognosis and therapeutic perspectives.
19734942 2009 RNA aptamers interfering with nucleophosmin oligomerization induce apoptosis of cancer cells.
19694479 2009 Interaction with checkpoint kinase 1 modulates the recruitment of nucleophosmin to chromatin.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19679658 2009 Nucleophosmin/B23 regulates ubiquitin dynamics in nucleoli by recruiting deubiquitylating enzyme USP36.
19679565 2009 The DNA methylome of pediatric acute lymphoblastic leukemia.
19672946 2009 Cuplike nuclei (prominent nuclear invaginations) in acute myeloid leukemia are highly associated with FLT3 internal tandem duplication and NPM1 mutation.
19642896 2009 GAGE, an antiapoptotic protein binds and modulates the expression of nucleophosmin/B23 and interferon regulatory factor 1.
19638589 2009 Nucleophosmin redistribution following heat shock: a role in heat-induced radiosensitization.
19637342 2009 Cytoplasmic localization of nucleophosmin in bone marrow blasts of acute myeloid leukemia patients is not completely concordant with NPM1 mutation and is not predictive of prognosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19587375 2009 Minimal residual disease levels assessed by NPM1 mutation-specific RQ-PCR provide important prognostic information in AML.
19581289 2009 Acetylated NPM1 localizes in the nucleoplasm and regulates transcriptional activation of genes implicated in oral cancer manifestation.
19569254 2009 Nucleophosmin (NPM1) mutations in adult and childhood acute myeloid leukaemia: towards definition of a new leukaemia entity.
19557552 2010 Incidence of FLT3 and nucleophosmin gene mutations in childhood acute myeloid leukemia: Serbian experience and the review of the literature.
19540590 2009 Detection of FLT3/ITD, JAK2(V617F) and NPM1 gene mutations in chronic myelomonocytic leukemia.
19536888 2009 Wilms tumor 1 gene mutations are associated with a higher risk of recurrence in young adults with acute myeloid leukemia: a study from the Acute Leukemia French Association.
19535344 2009 The effect of the cyclin-dependent kinase inhibitor flavopiridol on anaplastic large cell lymphoma cells and relationship with NPM-ALK kinase expression and activity.
19531656 2009 The proteomic signature of NPM/ALK reveals deregulation of multiple cellular pathways.
19522705 2009 Inhibiting Crm1 causes the formation of excess acentriolar spindle poles containing NuMA and B23, but does not affect centrosome numbers.
19484332 2009 Non-A type nucleophosmin 1 gene mutation predicts poor clinical outcome in de novo adult acute myeloid leukemia: differential clinical importance of NPM1 mutation according to subtype.
19429869 2009 AML with mutated NPM1 carrying a normal or aberrant karyotype show overlapping biologic, pathologic, immunophenotypic, and prognostic features.
19423729 2009 IGF-IR tyrosine kinase interacts with NPM-ALK oncogene to induce survival of T-cell ALK+ anaplastic large-cell lymphoma cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19410545 2009 HJURP is a cell-cycle-dependent maintenance and deposition factor of CENP-A at centromeres.
19379554 2009 [Analysis of NPM1 gene mutations in acute myeloid leukemia].
19369962 2009 Flow cytometric identification of acute myeloid leukemia with limited differentiation and NPM1 type A mutation: a new biologically defined entity.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19365794 2009 Mutations of NPM1 gene in de novo acute myeloid leukaemia: determination of incidence, distribution pattern and identification of two novel mutations in Indian population.
19351769 2009 Nucleophosmin as a candidate prognostic biomarker of Ewing's sarcoma revealed by proteomics.
19309322 2009 Comprehensive analysis of cooperative gene mutations between class I and class II in de novo acute myeloid leukemia.
19289604 2009 Folding mechanism of the C-terminal domain of nucleophosmin: residual structure in the denatured state and its pathophysiological significance.
19286999 2009 NPM-ALK inhibits the p53 tumor suppressor pathway in an MDM2 and JNK-dependent manner.
19279329 2009 NPM1 but not FLT3-ITD mutations predict early blast cell clearance and CR rate in patients with normal karyotype AML (NK-AML) or high-risk myelodysplastic syndrome (MDS).
19242062 2009 Detection of nucleophosmin gene mutations in plasma from patients with acute myeloid leukemia: clinical significance and implications.
19221506 2009 Nucleophosmin/B23 interacts with p21WAF1/CIP1 and contributes to its stability.
19188445 2009 APE1/Ref-1 interacts with NPM1 within nucleoli and plays a role in the rRNA quality control process.
19160485 2008 A ribosomal protein L23-nucleophosmin circuit coordinates Mizl function with cell growth.
19151774 2009 The prognostic impact of 17p (p53) deletion in 2272 adults with acute myeloid leukemia.
19131589 2009 Proteome-wide identification of novel binding partners to the oncogenic fusion gene protein, NPM-ALK, using tandem affinity purification and mass spectrometry.
19103589 2009 Nucleophosmin is cleaved and inactivated by the cytotoxic granule protease granzyme M during natural killer cell-mediated killing.
19066330 2009 Cytoplasmic nucleophosmin is not detected in blastic plasmacytoid dendritic cell neoplasm.
19059939 2009 Gene mutations and response to treatment with all-trans retinoic acid in elderly patients with acute myeloid leukemia. Results from the AMLSG Trial AML HD98B.
19055671 2009 Monitoring minimal residual disease in acute myeloid leukaemia with NPM1 mutations by quantitative PCR: clonal evolution is a limiting factor.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19052985 2008 Abnormal cytoplasmic dyslocalisation and/or reduction of nucleophosmin protein level rarely occurs in myelodysplastic syndromes.
19020547 2009 Favorable prognostic impact of NPM1 gene mutations in childhood acute myeloid leukemia, with emphasis on cytogenetically normal AML.
19015314 2008 Nucleolar protein B23/nucleophosmin regulates the vertebrate SUMO pathway through SENP3 and SENP5 proteases.
19005479 2009 A dose-dependent tug of war involving the NPM1 leukaemic mutant, nucleophosmin, and ARF.
18951898 2008 Nucleophosmin is required for chromosome congression, proper mitotic spindle formation, and kinetochore-microtubule attachment in HeLa cells.
18845790 2009 The enzymatic activity of 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase is enhanced by NPM-ALK: new insights in ALK-mediated pathogenesis and the treatment of ALCL.
18809582 2008 Nucleophosmin serves as a rate-limiting nuclear export chaperone for the Mammalian ribosome.
18729828 2008 Depletion of nucleophosmin leads to distortion of nucleolar and nuclear structures in HeLa cells.
18726096 2009 Nucleophosmin mutations in Chinese adults with acute myelogenous leukemia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18641025 2008 Nucleophosmin mutation in Southeast Asian acute myeloid leukemia: eight novel variants, FLT3 coexistence and prognostic impact of NPM1/FLT3 mutations.
18639523 2008 SMT3IP1, a nucleolar SUMO-specific protease, deconjugates SUMO-2 from nucleolar and cytoplasmic nucleophosmin.
18603563 2008 A one-mutation mathematical model can explain the age incidence of acute myeloid leukemia with mutated nucleophosmin (NPM1).
18596743 2009 Simultaneous occurrence of acute myeloid leukaemia with mutated nucleophosmin (NPM1) in the same family.
18590714 2008 Minimal residual disease detection in acute myeloid leukemia by mutant nucleophosmin (NPM1): comparison with WT1 gene expression.
18559874 2008 Wilms' tumor 1 gene mutations independently predict poor outcome in adults with cytogenetically normal acute myeloid leukemia: a cancer and leukemia group B study.
18511415 2008 Structural consequences of nucleophosmin mutations in acute myeloid leukemia.
18478020 2008 Therapy-related acute myeloid leukaemia with mutated NPM1: treatment induced or de novo in origin?
18454140 2008 p53-Driven apoptosis limits centrosome amplification and genomic instability downstream of NPM1 phosphorylation.
18448670 2008 Nucleophosmin is a binding partner of nucleostemin in human osteosarcoma cells.
18420587 2008 Ribosomal protein S9 is a novel B23/NPM-binding protein required for normal cell proliferation.
18371977 2008 Nucleophosmin interacts with HEXIM1 and regulates RNA polymerase II transcription.
18367491 2008 Cytoplasmic mutated nucleophosmin is stable in primary leukemic cells and in a xenotransplant model of NPMc+ acute myeloid leukemia in SCID mice.
18332108 2008 Transcription regulation of the rRNA gene by a multifunctional nucleolar protein, B23/nucleophosmin, through its histone chaperone activity.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18316603 2008 DNA damage-dependent translocation of B23 and p19 ARF is regulated by the Jun N-terminal kinase pathway.
18308931 2008 Distinctive microRNA signature of acute myeloid leukemia bearing cytoplasmic mutated nucleophosmin.
18298902 2008 Association of nucleophosmin/B23 with bladder cancer recurrence based on immunohistochemical assessment in clinical samples.
18273044 2008 NPM1 mutations in therapy-related acute myeloid leukemia with uncharacteristic features.
18268276 2008 NPM1 mutations and cytoplasmic nucleophosmin are mutually exclusive of recurrent genetic abnormalities: a comparative analysis of 2562 patients with acute myeloid leukemia.
18261272 2007 [A study of NPM1 and FLT3 gene mutations in acute myeloid leukemia].
18259216 2008 The nucleolar SUMO-specific protease SENP3 reverses SUMO modification of nucleophosmin and is required for rRNA processing.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18214681 2008 Characterisation of the Bax-nucleophosmin interaction: the importance of the Bax C-terminus.
18200037 2008 NPM1-mutated acute myeloid leukaemia occurring in JAK2-V617F+ primary myelofibrosis: de-novo origin?
18192111 2007 Prognostic significance of FLT3 internal tandem duplication and NPM1 mutations in acute myeloid leukemia in an unselected patient population.
18180033 2008 DR negativity is a distinctive feature of M1/M2 AML cases with NPM1 mutation.
18165222 2008 Nucleophosmin/B23 negatively regulates GCN5-dependent histone acetylation and transactivation.
18081718 2008 Clinical impact of nucleophosmin mutations and Flt3 internal tandem duplications in patients older than 60 yr with acute myeloid leukaemia.
18059485 2008 In human genome, generation of a nuclear export signal through duplication appears unique to nucleophosmin (NPM1) mutations and is restricted to AML.
18037965 2008 Influence of nucleophosmin/B23 on DNA binding and transcriptional activity of the androgen receptor in prostate cancer cell.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18024471 2008 The structure and functions of NPM1/Nucleophsmin/B23, a multifunctional nucleolar acidic protein.
17998938 2008 Activation of Rac1 and the exchange factor Vav3 are involved in NPM-ALK signaling in anaplastic large cell lymphomas.
17990177 2007 Lack of nucleophosmin mutation in patients with myelodysplastic syndrome and acute myeloid leukemia with chromosome 5 abnormalities.
17972951 2008 Characterization of acute myeloid leukemia with PTPN11 mutation: the mutation is closely associated with NPM1 mutation but inversely related to FLT3/ITD.
17968318 2008 Binding to nucleophosmin determines the localization of human and chicken ARF but not its impact on p53.
17957027 2008 The impact of FLT3 internal tandem duplication mutant level, number, size, and interaction with NPM1 mutations in a large cohort of young adult patients with acute myeloid leukemia.
17951246 2007 Ebp1 association with nucleophosmin/B23 is essential for regulating cell proliferation and suppressing apoptosis.
17943167 2008 Release of angiopoietin-1 by primary human acute myelogenous leukemia cells is associated with mutations of nucleophosmin, increased by bone marrow stromal cells and possibly antagonized by high systemic angiopoietin-2 levels.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17922009 2007 STAT5A is epigenetically silenced by the tyrosine kinase NPM1-ALK and acts as a tumor suppressor by reciprocally inhibiting NPM1-ALK expression.
17920239 2007 Can probability of genetic mutation be an indicator of clinical relevance?
17879352 2007 Crystal structure of human nucleophosmin-core reveals plasticity of the pentamer-pentamer interface.
17877154 2007 [Analysis of NPM1 gene mutations in acute myeloid leukemia].
17875528 2007 Analysis of NPM1 gene mutations in Chinese adults with acute myeloid leukemia.
17768124 2007 NPM1 mutations are more stable than FLT3 mutations during the course of disease in patients with acute myeloid leukemia.
17715399 2007 Association of nucleophosmin negatively regulates CXCR4-mediated G protein activation and chemotaxis.
17690700 2008 Nucleophosmin leukaemic mutants contain C-terminus peptides that bind HLA class I molecules.
17690253 2007 The oncoprotein NPM-ALK of anaplastic large-cell lymphoma induces JUNB transcription via ERK1/2 and JunB translation via mTOR signaling.
17639390 2007 Sustained expression of nucleophosmin (NPM1) mutation at late relapse presenting as isolated myeloid sarcoma in a patient with acute myeloid leukemia.
17637816 2007 Aberrant cytoplasmic expression of C-terminal-truncated NPM leukaemic mutant is dictated by tryptophans loss and a new NES motif.
17637812 2008 Absence of nucleophosmin leukaemic mutants in B and T cells from AML with NPM1 mutations: implications for the cell of origin of NPMc+ AML.
17616680 2007 Born to be exported: COOH-terminal nuclear export signals of different strength ensure cytoplasmic accumulation of nucleophosmin leukemic mutants.
17602943 2007 Physical and functional interaction between a nucleolar protein nucleophosmin/B23 and adenovirus basic core proteins.
17598835 2007 Distinctive expression of myelomonocytic markers and down-regulation of CD34 in acute myelogenous leukaemia with FLT3 tandem duplication and nucleophosmin mutation.
17597811 2007 Pediatric acute myeloid leukemia with NPM1 mutations is characterized by a gene expression profile with dysregulated HOX gene expression distinct from MLL-rearranged leukemias.
17569113 2007 Alteration of nuclear matrix-intermediate filament system and differential expression of nuclear matrix proteins during human hepatocarcinoma cell differentiation.
17549383 2007 PAI-1 induces cell detachment, downregulates nucleophosmin (B23) and fortilin (TCTP) in LnCAP prostate cancer cells.
17546053 2007 The leukemia-associated cytoplasmic nucleophosmin mutant is an oncogene with paradoxical functions: Arf inactivation and induction of cellular senescence.
17537995 2007 NPM/ALK binds and phosphorylates the RNA/DNA-binding protein PSF in anaplastic large-cell lymphoma.
17535915 2007 Sumoylation of nucleophosmin/B23 regulates its subcellular localization, mediating cell proliferation and survival.
17504301 2007 Absence of nucleophosmin 1 (NPM1) gene mutations in common solid cancers.
17488663 2007 Translocations and mutations involving the nucleophosmin (NPM1) gene in lymphomas and leukemias.
17475909 2007 The human Shwachman-Diamond syndrome protein, SBDS, associates with ribosomal RNA.
17440048 2007 The incidence and clinical significance of nucleophosmin mutations in childhood AML.
17438371 2007 Detection and identification of transcription factors as interaction partners of alien in vivo.
17410190 2007 A new type of NPM1 gene mutation in AML leading to a C-terminal truncated protein.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17318229 2007 Nucleophosmin acts as a novel AP2alpha-binding transcriptional corepressor during cell differentiation.
17315018 2007 No nucleophosmin mutations in pediatric acute myeloid leukemia with normal karyotype: a study of the Japanese Childhood AML Cooperative Study Group.
17306368 2007 Rapid screening and sensitive detection of NPM1 (nucleophosmin) exon 12 mutations in acute myeloid leukaemia.
17277230 2007 Nucleophosmin suppresses oncogene-induced apoptosis and senescence and enhances oncogenic cooperation in cells with genomic instability.
17215513 2007 Aurora-B regulates RNA methyltransferase NSUN2.
17151698 2007 Different types of NPM1 mutations in children and adults: evidence for an effect of patient age on the prevalence of the TCTG-tandem duplication in NPM1-exon 12.
17147251 2006 [Study of nucleophosmin (NPM) gene mutation in patients with acute myeloid leukemia and myelodysplastic syndromes].
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17076533 2006 Nucleophosmin gene mutations in acute myeloid leukemia.
17015463 2006 Interaction between ROCK II and nucleophosmin/B23 in the regulation of centrosome duplication.
16957780 2006 Antiviral action of the tumor suppressor ARF.
16926303 2006 High frequency of NPM1 gene mutations in acute myeloid leukemia with prominent nuclear invaginations ("cuplike" nuclei).
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16912078 2006 Effects of interphase and mitotic phosphorylation on the mobility and location of nucleolar protein B23.
16870548 2006 Mutations and promoter methylation status of NPM1 in myeloproliferative disorders.
16857742 2006 Ras-dependent recruitment of c-Myc for transcriptional activation of nucleophosmin/B23 in highly malignant U1 bladder cancer cells.
16855788 2006 DNA damage, p14ARF, nucleophosmin (NPM/B23), and cancer.
16835382 2006 A "liaison dangereuse" between AUF1/hnRNPD and the oncogenic tyrosine kinase NPM-ALK.
16825495 2006 Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.
16766651 2006 Nucleophosmin/anaplastic lymphoma kinase (NPM/ALK) oncoprotein induces the T regulatory cell phenotype by activating STAT3.
16725311 2006 Nucleophosmin/B23 regulates transcriptional activation of E2F1 via modulating the promoter binding of NF-kappaB, E2F1 and pRB.
16720834 2006 Immunohistochemistry predicts nucleophosmin (NPM) mutations in acute myeloid leukemia.
16709933 2006 NPM-ALK-dependent expression of the transcription factor CCAAT/enhancer binding protein beta in ALK-positive anaplastic large cell lymphoma.
16679321 2006 Essential role of the B23/NPM core domain in regulating ARF binding and B23 stability.
16678898 2007 NPM1 mutations in myelodysplastic syndromes and acute myeloid leukemia with normal karyotype.
16648475 2006 Nucleophosmin is essential for ribosomal protein L5 nuclear export.
16645213 2006 Denaturing high-performance liquid chromatography: a valid approach for identifying NPM1 mutations in acute myeloid leukemia.
16574551 2006 Cytoplasmic nucleophosmin in myeloid sarcoma occurring 20 years after diagnosis of acute myeloid leukaemia.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16547420 2006 Nucleolar protein B23 interacts with Japanese encephalitis virus core protein and participates in viral replication.
16541144 2006 Quantitative assessment of minimal residual disease in acute myeloid leukemia carrying nucleophosmin (NPM1) gene mutations.
16455956 2006 Prevalence and prognostic impact of NPM1 mutations in 1485 adult patients with acute myeloid leukemia (AML).
16455950 2006 Both carboxy-terminus NES motif and mutated tryptophan(s) are crucial for aberrant nuclear export of nucleophosmin leukemic mutants in NPMc+ AML.
16415342 2006 Requirement of the protein B23 for nucleolar disassembly induced by the FRGY2a family proteins.
16376884 2006 Characterisation of the interface between nucleophosmin (NPM) and p53: potential role in p53 stabilisation.
16376875 2006 Thr199 phosphorylation targets nucleophosmin to nuclear speckles and represses pre-mRNA processing.
16205118 2005 Myeloid leukemia-associated nucleophosmin mutants perturb p53-dependent and independent activities of the Arf tumor suppressor protein.
16170350 2006 Hepatitis C virus core protein recruits nucleolar phosphoprotein B23 and coactivator p300 to relieve the repression effect of transcriptional factor YY1 on B23 gene expression.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16107701 2005 Human histone chaperone nucleophosmin enhances acetylation-dependent chromatin transcription.
16076867 2005 Nucleophosmin gene mutations are predictors of favorable prognosis in acute myelogenous leukemia with a normal karyotype.
16046528 2005 Prevalence, clinical profile, and prognosis of NPM mutations in AML with normal karyotype.
16041368 2005 Temporal and spatial control of nucleophosmin by the Ran-Crm1 complex in centrosome duplication.
15994285 2005 Clinical characteristics and prognostic implications of NPM1 mutations in acute myeloid leukemia.
15989956 2005 ARF-BP1/Mule is a critical mediator of the ARF tumor suppressor.
15973451 2005 Simultaneous detection of NPM1 and FLT3-ITD mutations by capillary electrophoresis in acute myeloid leukemia.
15964625 2005 Negative regulation of p53 by nucleophosmin antagonizes stress-induced apoptosis in human normal and malignant hematopoietic cells.
15897463 2005 Sumoylation induced by the Arf tumor suppressor: a p53-independent function.
15872011 2005 Polyamine depletion induces nucleophosmin modulating stability and transcriptional activity of p53 in intestinal epithelial cells.
15870172 2005 Nucleophosmin mutations in childhood acute myelogenous leukemia with normal karyotype.
15831697 2005 Acute myeloid leukemia bearing cytoplasmic nucleophosmin (NPMc+ AML) shows a distinct gene expression profile characterized by up-regulation of genes involved in stem-cell maintenance.
15772089 2005 RPGR ORF15 isoform co-localizes with RPGRIP1 at centrioles and basal bodies and interacts with nucleophosmin.
15684379 2005 Nucleophosmin (B23) targets ARF to nucleoli and inhibits its function.
15665273 2005 Down-regulation of BRCA1-BARD1 ubiquitin ligase by CDK2.
15659725 2005 Cytoplasmic nucleophosmin in acute myelogenous leukemia with a normal karyotype.
15644315 2005 B23 regulates GADD45a nuclear translocation and contributes to GADD45a-induced cell cycle G2-M arrest.
15635413 2005 Nucleolar proteome dynamics.
15615785 2005 PARP-1 and PARP-2 interact with nucleophosmin/B23 and accumulate in transcriptionally active nucleoli.
15589822 2004 c-Myc-mediated expression of nucleophosmin/B23 decreases during retinoic acid-induced differentiation of human leukemia HL-60 cells.
15514966 2005 Release of nucleophosmin from the nucleus: Involvement in aloe-emodin-induced human lung non small carcinoma cell apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15388344 2004 Nek2A kinase regulates the localization of numatrin to centrosome in mitosis.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15310764 2004 Hypoxia-induced nucleophosmin protects cell death through inhibition of p53.
15190079 2004 B23/nucleophosmin serine 4 phosphorylation mediates mitotic functions of polo-like kinase 1.
15184379 2004 Nucleophosmin/B23 is a candidate substrate for the BRCA1-BARD1 ubiquitin ligase.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
15144954 2004 Nucleolar protein NPM interacts with HDM2 and protects tumor suppressor protein p53 from HDM2-mediated degradation.
15087454 2004 Identification of nucleophosmin as an NF-kappaB co-activator for the induction of the human SOD2 gene.
15082766 2004 Nucleophosmin sets a threshold for p53 response to UV radiation.
14759373 2004 CTCF tethers an insulator to subnuclear sites, suggesting shared insulator mechanisms across species.
14730621 2004 Selective cleavage of nucleolar autoantigen B23 by granzyme B in differentiated vascular smooth muscle cells: insights into the association of specific autoantibodies with distinct disease phenotypes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656879 2004 Bcl-XL down-regulation suppresses the tumorigenic potential of NPM/ALK in vitro and in vivo.
14636574 2003 Tumor suppressor ARF degrades B23, a nucleolar protein involved in ribosome biogenesis and cell proliferation.
14563642 2004 Nucleophosmin-anaplastic lymphoma kinase of anaplastic large-cell lymphoma recruits, activates, and uses pp60c-src to mediate its mitogenicity.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
14519847 2003 Unique conformation of cancer autoantigen B23 in hepatoma: a mechanism for specificity in the autoimmune response.
14506644 2003 Detection of NPM/MLF1 fusion in t(3;5)-positive acute myeloid leukemia and myelodysplasia.
12882984 2003 Nucleophosmin interacts with and inhibits the catalytic function of eukaryotic initiation factor 2 kinase PKR.
12748172 2003 Identification and characterization of a nuclear interacting partner of anaplastic lymphoma kinase (NIPA).
12511551 2003 Role of protein kinase CK2 phosphorylation in the molecular chaperone activity of nucleolar protein b23.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450141 2002 Tryptophans 286 and 288 in the C-terminal region of protein B23.1 are important for its nucleolar localization.
12429849 2002 Functional proteomic analysis of human nucleolus.
12374805 2002 UV stimulation of nucleophosmin/B23 expression is an immediate-early gene response induced by damaged DNA.
12214246 2002 The role of nucleophosmin in centrosome duplication.
12209603 2002 Increased expression of a COOH-truncated nucleophosmin resulting from alternative splicing is associated with cellular resistance to ionizing radiation in HeLa cells.
12080348 2002 Nucleophosmin regulates the stability and transcriptional activity of p53.
12058066 2002 The RNA binding activity of a ribosome biogenesis factor, nucleophosmin/B23, is modulated by phosphorylation with a cell cycle-dependent kinase and by association with its subtype.
12057857 2002 A major nucleolar protein B23 as a marker of proliferation activity of human peripheral lymphocytes.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
12031912 2002 Overexpression of translocation-associated fusion genes of FGFRI, MYC, NPMI, and DEK, but absence of the translocations in acute myeloid leukemia. A microarray analysis.
11888936 2002 Nucleophosmin-anaplastic lymphoma kinase (NPM-ALK), a novel Hsp90-client tyrosine kinase: down-regulation of NPM-ALK expression and tyrosine phosphorylation in ALK(+) CD30(+) lymphoma cells by the Hsp90 antagonist 17-allylamino,17-demethoxygeldanamycin.
11812799 2002 The basic helix-loop-helix factor, HAND2, functions as a transcriptional activator by binding to E-boxes as a heterodimer.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11602260 2001 Function of nucleophosmin/B23, a nucleolar acidic protein, as a histone chaperone.
11420665 2001 Diverged nuclear localization of Werner helicase in human and mouse cells.
11309377 2001 The nucleolar phosphoprotein B23 interacts with hepatitis delta antigens and modulates the hepatitis delta virus RNA replication.
11278991 2001 Specific phosphorylation of nucleophosmin on Thr(199) by cyclin-dependent kinase 2-cyclin E and its role in centrosome duplication.
11215285 2001 Anaplastic large cell lymphoma with the t(2;5)(p23;q35) NPM/ALK chromosomal translocation and duplication of the short arm of the non-translocated chromosome 2 involving the full length of the ALK gene.
11051553 2000 Nucleophosmin/B23 is a target of CDK2/cyclin E in centrosome duplication.
10503877 1999 In vivo interaction of nucleophosmin/B23 and protein C23 during cell cycle progression in HeLa cells.
10211837 1999 Nucleolar protein B23 has molecular chaperone activities.
9819383 1998 Nucleophosmin-anaplastic lymphoma kinase of large-cell anaplastic lymphoma is a constitutively active tyrosine kinase that utilizes phospholipase C-gamma to mediate its mitogenicity.
9763551 1998 The cryptic inv(2)(p23q35) defines a new molecular genetic subtype of ALK-positive anaplastic large-cell lymphoma.
9642267 1998 A B-cell-specific DNA recombination complex.
9548374 1998 The SURF-6 protein is a component of the nucleolar matrix and has a high binding capacity for nucleic acids in vitro.
9150948 A two-dimensional gel database of human colon carcinoma proteins.
9150888 1996 The post-transcriptional regulator Rev of HIV: implications for its interaction with the nucleolar protein B23.
9121481 1997 Role of the nucleophosmin (NPM) portion of the non-Hodgkin's lymphoma-associated NPM-anaplastic lymphoma kinase fusion protein in oncogenesis.
9094689 1997 Protein B23 is an important human factor for the nucleolar localization of the human immunodeficiency virus protein Tat.
9092824 1997 Nucleolar protein B23 stimulates nuclear import of the HIV-1 Rev protein and NLS-conjugated albumin.
9092633 1997 Isolation and characterization of the human nucleophosmin/B23 (NPM) gene: identification of the YY1 binding site at the 5' enhancer region.
8778315 1996 Expression of nucleophosmin/B23 in normal and neoplastic colorectal mucosa.
8633037 1996 Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5).
8620867 1996 C23 interacts with B23, a putative nucleolar-localization-signal-binding protein.
8570204 1996 The t(3;5)(q25.1;q34) of myelodysplastic syndrome and acute myeloid leukemia produces a novel fusion gene, NPM-MLF1.
8562957 1996 The t(5;17) variant of acute promyelocytic leukemia expresses a nucleophosmin-retinoic acid receptor fusion.
8471164 1993 Characterization of seven processed pseudogenes of nucleophosmin/B23 in the human genome.
8314759 1993 Nucleolar targeting signal of Rex protein of human T-cell leukemia virus type I specifically binds to nucleolar shuttle protein B-23.
8224012 1993 Cytotoxic activity of rev protein of human immunodeficiency virus type 1 by nucleolar dysfunction.
8122112 1994 Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma.
8089149 1994 Identification of the nuclear and nucleolar localization signals of the protein p120. Interaction with translocation protein B23.
7826206 1994 Spatial association of HIV-1 tat protein and the nucleolar transport protein B23 in stably transfected Jurkat T-cells.
7821789 1994 Construction of a human full-length cDNA bank.
7794916 1995 Interaction of nucleolar protein B23 with peptides related to nuclear localization signals.
7631008 1995 Modification of nucleolar protein B23 after exposure to ionizing radiation.
7628555 1995 The cytotoxicity of human immunodeficiency virus type 1 Rev: implications for its interaction with the nucleolar protein B23.
7593322 1995 The roles of nucleolar structure and function in the subcellular location of the HIV-1 Rev protein.
7542384 1995 In vitro and ex vivo expression of nucleolar proteins B23 and p120 in benign and malignant epithelial lesions of the prostate.
3944116 1986 Amino acid sequence of protein B23 phosphorylation site.
2775293 1989 The nucleotide sequence of a human cDNA encoding the highly conserved nucleolar phosphoprotein B23.
2713355 1989 Characterization of the cDNA encoding human nucleophosmin and studies of its role in normal and abnormal growth.
2602120 1989 Nucleotide sequence of a cDNA clone representing a third allele of human protein B23.
2478125 1989 Isolation and characterization of a molecular cDNA clone of a human mRNA from interferon-treated cells encoding nucleolar protein B23, numatrin.
2429957 1986 Amino acid sequence of a specific antigenic peptide of protein B23.
2404140 1990 Identification of sequences important in the nucleolar localization of human immunodeficiency virus Rev: relevance of nucleolar localization to function.
2109912 1990 Functional domains of the HIV-1 rev gene required for trans-regulation and subcellular localization.
2017166 1991 Specific complex of human immunodeficiency virus type 1 rev and nucleolar B23 proteins: dissociation by the Rev response element.