Property Summary

NCBI Gene PubMed Count 5
PubMed Score 94.63
PubTator Score 24.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Sleep apnea 7 3.467 1.7
Umbilical hernia 93 3.262 1.6

Expression

Gene RIF (2)

AA Sequence

MFCCLGYEWLSGGCKTWHSAWVINTLADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCTSYLCVSFLKT      1 - 70
IFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKR     71 - 140
KTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYRCKITPSARKP    141 - 210
LCNRVRMAAVEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSIIDNSLSLKTPSECLLTPLPPSALP    211 - 280
SADDNLKTPAECLLYPLPPSADDNLKTPPECLLTPLPPSAPPSVDDNLKTPPECVCSLPFHPQRMIISRN    281 - 350
//

Text Mined References (6)

PMID Year Title