Property Summary

Ligand Count 65
NCBI Gene PubMed Count 253
PubMed Score 773.12
PubTator Score 374.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.700 9.3e-08
Astrocytoma, Pilocytic 2.000 9.8e-07
atypical teratoid / rhabdoid tumor 2.500 8.8e-09
Breast cancer 1.800 4.9e-08
cystic fibrosis 2.700 4.6e-06
ependymoma 2.200 3.5e-09
glioblastoma 2.700 1.4e-11
group 3 medulloblastoma 2.300 6.9e-06
interstitial cystitis 1.100 4.6e-03
invasive ductal carcinoma 2.133 3.1e-05
lung adenocarcinoma 1.300 4.6e-05
medulloblastoma, large-cell 1.800 4.0e-04
nephrosclerosis -1.095 2.8e-02
non-small cell lung cancer 1.688 2.1e-13
ovarian cancer 1.500 4.5e-03
pancreatic cancer 2.000 1.3e-04
primary pancreatic ductal adenocarcinoma 1.295 1.3e-02
primitive neuroectodermal tumor 2.000 3.2e-03
X-linked cerebral adrenoleukodystrophy 1.300 3.4e-02

Protein-protein Interaction (4)

Gene RIF (247)

AA Sequence

MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSL      1 - 70
ILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFVE     71 - 140
LNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSG    141 - 210
GLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANF    211 - 280
PQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALE    281 - 350
NHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES    351 - 420
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPD    421 - 490
YVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLS    491 - 560
NQNNSYGTRFEYNKESFS                                                        561 - 578
//

Text Mined References (254)

PMID Year Title