Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.40
PubTator Score 13.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 9.7e-03
osteosarcoma -3.048 1.4e-04
non-small cell lung cancer -3.626 2.5e-39
lung adenocarcinoma -2.600 7.2e-13
psoriasis -1.400 6.3e-08
inflammatory breast cancer -1.900 8.1e-03
lung carcinoma -2.400 2.2e-14
invasive ductal carcinoma -2.100 1.7e-03

 GO Function (1)

Gene RIF (12)

PMID Text
24588201 no significant difference in serum level associated with preeclampsia or intrauterine growth restriction
23592143 This study showed that overexpression of NOSTRIN had a significant effect on eNOS activity in HUVECs and resulted in significant cellular damage.
21351530 The expression of NOSTRIN is decreased, while the activity of eNOS and the level of NO2-/NO3- increased in the testis tissue of azoospermia patients.
21183735 Results reveal an elegant mechanism of eNOS regulation by PECAM-1 through signal transducers and activators of transcription 3-mediated transcriptional control of NOSTRIN.
20442744 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
19399414 NOSTRIN expression was increased in umbilical vessel of women with pre-eclampsia.
18980613 results suggest that nuclear NOSTRINbeta may negatively regulate transcription of the NOSTRIN gene
16807357 A ternary complex between NOSTRIN, caveolin-1, and eNOS mediates translocation of eNOS, with important implications for the activity and availability of eNOS in the cell.
16234328 NOSTRIN may facilitate endocytosis of endothelial nitric oxide synthase by coordinating the function of dynamin and the actin nucleation promoting factor N-WASP.
12446846 NOSTRIN modulates nitric oxide release and subcellular distribution of endothelial nitric oxide synthase.

AA Sequence

MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKALQNTRKSCVSS      1 - 70
AWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKL     71 - 140
MVSTKKHEALFQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLKWENTLENCYQ    141 - 210
SILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFL    211 - 280
LTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD    281 - 350
ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASS    351 - 420
GGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEGGWWFGSLNGKKGHFPAA    421 - 490
YVEELPSNAGNTATKA                                                          491 - 506
//

Text Mined References (25)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24588201 2015 The relation of maternal serum eNOS, NOSTRIN and ADMA levels with aetiopathogenesis of preeclampsia and/or intrauterine fetal growth restriction.
23592143 2013 Changes in human umbilical vein endothelial cells induced by endothelial nitric oxide synthase traffic inducer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22751148 2012 The F-BAR protein NOSTRIN participates in FGF signal transduction and vascular development.
21351530 2011 [Expression of NOSTRIN in the testis tissue of azoospermia patients].
21183735 2011 Platelet-endothelial cell adhesion molecule-1 regulates endothelial NO synthase activity and localization through signal transducers and activators of transcription 3-dependent NOSTRIN expression.
20442744 2010 Linkage and candidate gene studies of autism spectrum disorders in European populations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19399414 2009 Endothelial nitric oxide synthase traffic inducer in the umbilical vessels of the patients with pre-eclampsia.
18980613 2009 NOSTRINbeta--a shortened NOSTRIN variant with a role in transcriptional regulation.
16807357 2006 Translocation of endothelial nitric-oxide synthase involves a ternary complex with caveolin-1 and NOSTRIN.
16722822 2006 Subcellular targeting and trafficking of nitric oxide synthases.
16376344 2006 FCH/Cdc15 domain determines distinct subcellular localization of NOSTRIN.
16234328 2005 NOSTRIN functions as a homotrimeric adaptor protein facilitating internalization of eNOS.
15847871 2005 Expression of endothelial nitric oxide synthase traffic inducer in the placentas of women with pre-eclampsia.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15596140 2005 Cloning and characterization of mouse disabled 2 interacting protein 2, a mouse orthologue of human NOSTRIN.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446846 2002 NOSTRIN: a protein modulating nitric oxide release and subcellular distribution of endothelial nitric oxide synthase.
11489260 2001 Altered gene expression in cerebral capillaries of stroke-prone spontaneously hypertensive rats.