Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.35
PubTator Score 5.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.600 1.4e-04
astrocytic glioma -1.600 1.4e-02
Astrocytoma, Pilocytic -1.900 6.5e-05
atypical teratoid / rhabdoid tumor -3.800 5.4e-07
ependymoma -2.400 3.3e-02
glioblastoma -2.000 1.1e-04
lung carcinoma 4.700 1.4e-29
medulloblastoma -1.700 2.5e-02
medulloblastoma, large-cell -3.700 1.3e-04
oligodendroglioma -1.200 2.5e-02
ovarian cancer -1.300 2.7e-06
pituitary cancer 1.400 1.2e-02
primitive neuroectodermal tumor -2.700 1.0e-03
psoriasis -2.300 3.6e-24

Gene RIF (2)

AA Sequence

MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEV      1 - 70
RGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAIS     71 - 140
ESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQ    141 - 210
QDEDESSIESDEFDMSDSTRMSAVNSDLSSNLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGG    211 - 280
THSREMGDSNSDGKTGLEQDEQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENG    281 - 350
SKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD    351 - 420
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPIPSHLTSAVAE    421 - 490
SILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYRG    491 - 560
LGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADEL    561 - 630
ENLILQQN                                                                  631 - 638
//

Text Mined References (15)

PMID Year Title