Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.23
PubTator Score 5.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.600 1.4e-02
ependymoma -2.900 1.8e-11
oligodendroglioma -1.200 2.5e-02
glioblastoma -3.400 7.5e-05
atypical teratoid / rhabdoid tumor -3.800 5.4e-07
medulloblastoma -1.700 2.5e-02
medulloblastoma, large-cell -3.700 1.3e-04
primitive neuroectodermal tumor -2.700 1.0e-03
pediatric high grade glioma -2.600 4.2e-05
pilocytic astrocytoma -1.900 6.4e-05
lung carcinoma 4.700 1.4e-29
ovarian cancer -1.600 1.5e-06
pituitary cancer 1.400 1.2e-02
psoriasis -2.300 3.6e-24

Synonym

Accession O94818 B4DSQ0 B7Z3Z7 F5H1E3 Q6IBS2 Q9BWF1
Symbols NOLP
CT125
HRIHFB2255

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
24337411 NOL4 was identified as a highly specific promoter methylated gene associated with head and neck squamous cell carcinoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MESERDMYRQFQDWCLRTYGDSGKTKTVTRKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEV      1 - 70
RGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAIS     71 - 140
ESYAFLPREAVTRFLMSCSECQKRMHLNPDGTDHKDNGKPPTLVTSMIDYNMPITMAYMKHMKLQLLNSQ    141 - 210
QDEDESSIESDEFDMSDSTRMSAVNSDLSSNLEERMQSPQNLHGQQDDDSAAESFNGNETLGHSSIASGG    211 - 280
THSREMGDSNSDGKTGLEQDEQPLNLSDSPLSAQLTSEYRIDDHNSNGKNKYKNLLISDLKMEREARENG    281 - 350
SKSPAHSYSSYDSGKNESVDRGAEDLSLNRGDEDEDDHEDHDDSEKVNETDGVEAERLKAFNMFVRLFVD    351 - 420
ENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEMSRPIPSHLTSAVAE    421 - 490
SILASACESESRNAAKRMRLERQQDESAPADKQCKPEATQATYSTSAVPGSQDVLYINGNGTYSYHSYRG    491 - 560
LGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADEL    561 - 630
ENLILQQN                                                                  631 - 638
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24337411 2014 Validation of nucleolar protein 4 as a novel methylated tumor suppressor gene in head and neck cancer.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19846067 2010 A genomewide association study of citalopram response in major depressive disorder.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9853615 1998 Selection system for genes encoding nuclear-targeted proteins.
9813152 1998 NOLP: identification of a novel human nucleolar protein and determination of sequence requirements for its nucleolar localization.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.