Property Summary

NCBI Gene PubMed Count 54
PubMed Score 217.56
PubTator Score 172.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.100 3.4e-04
osteosarcoma -1.240 1.2e-03
astrocytoma 1.100 3.5e-03
atypical teratoid / rhabdoid tumor -1.200 1.5e-05
glioblastoma -1.400 5.8e-04
primitive neuroectodermal tumor -1.100 1.1e-02
lung cancer 1.400 6.2e-03
adult high grade glioma -1.100 9.2e-04
group 4 medulloblastoma -1.100 4.9e-05
ovarian cancer 2.200 5.8e-05
dermatomyositis 1.100 2.1e-03

Gene RIF (50)

PMID Text
26603938 These observations point at a previously unrecognized contribution of calnexin to the retention of NMT1 at the ER membrane.
26074144 findings suggest that both NMT1 and hnRNP A2/B1 take part in the regulation of HIV-1 RNA expression through their mutual opposite effects on the viral RNA expression in HIV-1-producing cells
23184449 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21653836 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21449607 we propose a model of the Nef:NMT complex in which only the myristoyl moiety holds the two proteins together in complex and speculate that perhaps NMT chaperones Nef to the membrane and thereby protects the myristic acid group from the cytosol
21449607 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19403686 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18248763 These results strongly suggest that HIV-1 production is specifically associated with hNMT1, particularly hNMT1(L), but not with hNMT2 in vivo, contributing to the understanding of a step in HIV-1 replication.
18248763 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18187620 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18187620 Knockdown of N-myristoyltransferase 1 (NMT1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18089753 Nef is preferentially myristoylated by NMT2, suggesting that selective inhibition of NMT2 may provide a novel means of blocking HIV virulence.
18089753 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18021392 N-myristoyltransferase may have a role in progression of colonic neoplasms
17549352 Elevated N-myristoyltransferase activity is associated with oral squamous cell carcinoma
17411366 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17261081 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17188710 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
16475823 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
16306631 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
16216583 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
16183191 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
16123142 NMT1 and NMT2 have only partially overlapping functions; NMT1 is critical for tumor cell proliferation
15613341 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
15280532 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
15156568 role of HSC70 in the regulation of NMT
14707265 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14699046 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12767222 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12244217 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12220649 In this study, we found decreases in the mRNA levels of human NMT isoforms and the NMT activities in the course of HIV-1 infection in the human T-cell line
11463741 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
11302743 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
10339411 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
10196310 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
10074105 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9971769 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9299393 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9261380 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
8970978 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
8576268 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
8139035 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
7521919 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
2788277 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
2737204 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
2692561 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
2405382 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
2194551 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSE      1 - 70
TDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEP     71 - 140
DKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQW    141 - 210
HCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAV    211 - 280
YTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVH    281 - 350
QLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY    351 - 420
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEK    421 - 490
VGLVLQ                                                                    491 - 496
//

Text Mined References (62)

PMID Year Title
26603938 2015 N-Myristoyltransferase 1 interacts with calnexin at the endoplasmic reticulum.
26074144 2015 N-Myristoyltransferase 1 enhances human immunodeficiency virus replication through regulation of viral RNA expression level.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21449607 2011 Effects of HIV-1 Nef on human N-myristoyltransferase 1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18248763 2008 HIV-1 production is specifically associated with human NMT1 long form in human NMT isozymes.
18089753 2008 N-Myristoyltransferase isozymes exhibit differential specificity for human immunodeficiency virus type 1 Gag and Nef.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18021392 2007 N-myristoyltransferase: a potential novel diagnostic marker for colon cancer.
17549352 2007 Elevated N-myristoyltransferase activity and expression in oral squamous cell carcinoma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16123142 2005 Two N-myristoyltransferase isozymes play unique roles in protein myristoylation, proliferation, and apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15156568 2004 N-myristoyltransferase inhibitor protein is homologous to heat shock cognate protein 70.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12767222 2003 Role of myristylation in HIV-1 Gag assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414990 2002 A developmentally regulated ARF-like 5 protein (ARL5), localized to nuclei and nucleoli, interacts with heterochromatin protein 1.
12244217 2002 Myristoylation as a target for inhibiting HIV assembly: unsaturated fatty acids block viral budding.
12220649 2002 Novel strategy for anti-HIV-1 action: selective cytotoxic effect of N-myristoyltransferase inhibitor on HIV-1-infected cells.
11594778 2001 Phosphorylation of human N-myristoyltransferase by N-myristoylated SRC family tyrosine kinase members.
11423543 2001 Heterogeneous fatty acylation of Src family kinases with polyunsaturated fatty acids regulates raft localization and signal transduction.
11302743 2001 Myristoylation of human immunodeficiency virus type 1 gag protein is required for efficient env protein transportation to the surface of cells.
11099414 2000 Posttranslational N-myristoylation of BID as a molecular switch for targeting mitochondria and apoptosis.
10734119 2000 Molecular cloning, genomic organization, and biochemical characterization of myristoyl-CoA:protein N-myristoyltransferase from Arabidopsis thaliana.
10718634 2000 N-myristoyltransferase.
10625670 2000 Five members of a novel Ca(2+)-binding protein (CABP) subfamily with similarity to calmodulin.
10196310 1999 Binding of human immunodeficiency virus type 1 Gag to membrane: role of the matrix amino terminus.
10074105 1999 Opposing effects of human immunodeficiency virus type 1 matrix mutations support a myristyl switch model of gag membrane targeting.
9971769 1999 Human immunodeficiency virus type 1 protease triggers a myristoyl switch that modulates membrane binding of Pr55(gag) and p17MA.
9677304 1998 Characterization of human and rat brain myristoyl-CoA:protein N-myristoyltransferase: evidence for an alternative splice variant of the enzyme.
9506952 1998 A second mammalian N-myristoyltransferase.
9353336 1997 Human N-myristoyltransferase amino-terminal domain involved in targeting the enzyme to the ribosomal subcellular fraction.
9299393 1997 Blockage of N-myristoylation of HIV-1 gag induces the production of impotent progeny virus.
9261380 1997 Membrane binding of human immunodeficiency virus type 1 matrix protein in vivo supports a conformational myristyl switch mechanism.
9110174 1997 Large-scale concatenation cDNA sequencing.
8970978 1996 Differential membrane binding of the human immunodeficiency virus type 1 matrix protein.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8576268 1996 Complete inhibition of human immunodeficiency virus Gag myristoylation is necessary for inhibition of particle budding.
8360179 1993 Myristoylation of hippocalcin is linked to its calcium-dependent membrane association properties.
8139035 1994 Identification of a membrane-binding domain within the amino-terminal region of human immunodeficiency virus type 1 Gag protein which interacts with acidic phospholipids.
7527558 1994 Amino-terminal basic residues of Src mediate membrane binding through electrostatic interaction with acidic phospholipids.
7521919 1994 Efficient particle formation can occur if the matrix domain of human immunodeficiency virus type 1 Gag is substituted by a myristylation signal.
7512951 1994 Identification of covalently bound amino-terminal myristic acid in endothelial nitric oxide synthase.
3917576 1985 Amino terminal myristylation of the protein kinase p60src, a retroviral transforming protein.
2788277 1989 Role of capsid precursor processing and myristoylation in morphogenesis and infectivity of human immunodeficiency virus type 1.
2737204 1989 Chemical characterization of p17gag from human immunodeficiency virus as an N-terminally myristoylated protein.
2692561 1989 Antimyristoylation of the gag proteins in the human immunodeficiency virus-infected cells with N-myristoyl glycinal diethylacetal resulted in inhibition of virus production.
2405382 1990 Myristoylation-dependent replication and assembly of human immunodeficiency virus 1.
2194551 1990 Myristoylation of gag proteins of HIV-1 plays an important role in virus assembly.
2153964 1990 G-protein alpha-subunit expression, myristoylation, and membrane association in COS cells.
1570339 1992 Mutations of human myristoyl-CoA:protein N-myristoyltransferase cause temperature-sensitive myristic acid auxotrophy in Saccharomyces cerevisiae.
1530946 1992 A strategy for isolation of cDNAs encoding proteins affecting human intestinal epithelial cell growth and differentiation: characterization of a novel gut-specific N-myristoylated annexin.