Property Summary

Ligand Count 72
NCBI Gene PubMed Count 56
PubMed Score 222.50
PubTator Score 172.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 9.2e-04
astrocytoma 1.100 3.5e-03
atypical teratoid / rhabdoid tumor -1.200 1.5e-05
dermatomyositis 1.100 2.1e-03
glioblastoma -1.400 5.8e-04
group 4 medulloblastoma -1.100 4.9e-05
lung cancer 1.400 6.2e-03
osteosarcoma -1.240 1.2e-03
ovarian cancer -1.100 2.2e-07
primitive neuroectodermal tumor -1.100 1.1e-02
psoriasis -1.100 3.4e-04

Gene RIF (51)

AA Sequence

MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSE      1 - 70
TDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEP     71 - 140
DKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQW    141 - 210
HCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAV    211 - 280
YTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVH    281 - 350
QLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY    351 - 420
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEK    421 - 490
VGLVLQ                                                                    491 - 496
//

Text Mined References (64)

PMID Year Title