Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.66
PubTator Score 3.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 3.0e-02
atypical teratoid / rhabdoid tumor -1.800 6.1e-06
cystic fibrosis -1.500 1.2e-03
esophageal adenocarcinoma -1.400 3.8e-02
glioblastoma -1.100 9.6e-03
group 4 medulloblastoma -1.500 2.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 3.3e-02
lung cancer -1.500 3.2e-02
malignant mesothelioma -3.600 6.5e-09
medulloblastoma, large-cell -2.900 3.6e-06
ovarian cancer -1.600 1.8e-04
pancreatic cancer -1.400 1.8e-02
pituitary cancer -1.100 5.7e-05
primary pancreatic ductal adenocarcinoma -1.441 2.0e-02
primitive neuroectodermal tumor -1.400 9.4e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAI      1 - 70
SCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSP     71 - 140
GYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA               141 - 199
//

Text Mined References (11)

PMID Year Title