Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.97
PubTator Score 17.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.800 1.7e-05
astrocytic glioma -1.800 6.9e-03
Astrocytoma, Pilocytic -2.200 5.4e-07
atypical teratoid / rhabdoid tumor -3.400 2.3e-07
cystic fibrosis 1.109 2.3e-04
Down syndrome -1.100 4.8e-02
ductal carcinoma in situ -1.800 9.2e-04
ependymoma -1.400 4.5e-02
fibroadenoma -1.100 7.8e-03
glioblastoma -2.600 1.1e-07
group 3 medulloblastoma -2.700 6.4e-04
invasive ductal carcinoma -1.800 1.0e-02
lung carcinoma 2.600 7.0e-47
malignant mesothelioma -2.300 2.0e-06
medulloblastoma, large-cell -2.100 2.9e-03
oligodendroglioma -1.600 1.0e-09
osteosarcoma -2.295 4.6e-07
ovarian cancer -1.500 1.7e-08
Pick disease -1.600 2.2e-03
primitive neuroectodermal tumor -1.200 1.4e-02
subependymal giant cell astrocytoma -4.159 3.7e-03

Gene RIF (17)

AA Sequence

MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMC      1 - 70
QLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQN     71 - 140
SNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCGSDLLESFCIP    141 - 210
GLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHG    211 - 280
DGHVVDYLSQPVIDYILKSQLYINASG                                               281 - 307
//

Text Mined References (31)

PMID Year Title