Property Summary

NCBI Gene PubMed Count 16
PubMed Score 44.04
PubTator Score 20.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.543 3.5e-06
group 3 medulloblastoma -1.200 4.8e-04
posterior fossa group B ependymoma -1.100 4.4e-07
ovarian cancer 1.800 9.7e-08

 CSPA Cell Line (1)

Protein-protein Interaction (1)

Gene RIF (4)

PMID Text
24842555 Neuroligin-2 was down-regulated in aganglionic colonic segments from Hirschsprung's disease patients.
22528485 Transcellular neuroligin-2 interactions enhance insulin secretion and are integral to pancreatic beta cell function
21551456 Data identified the R215H mutant as a loss-of-function mutant in inducing GABAergic synaptogenesis. Data also suggests that defects in GABAergic synapse formation in the brain may be an important contributing factor for the onset of schizophrenia.
19086053 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNNEILGPVVQFL      1 - 70
GVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSED     71 - 140
CLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVMLFLHGGSYMEGTGNMFDGSVLAAYGNVIVA    141 - 210
TLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHS    211 - 280
EGLFQKAIAQSGTAISSWSVNYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIA    281 - 350
FGPVVDGDVVPDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY    351 - 420
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHHCQAE    421 - 490
GRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHT    491 - 560
KPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAFWLELVPHLHNLHTELFTTTTRLPPYATRWP    561 - 630
PRPPAGAPGTRRPPPPATLPPEPEPEPGPRAYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYK    631 - 700
RDRRQELRCRRLSPPGGSGSGVPGGGPLLPAAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYT    701 - 770
LALRRAPDDVPLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV         771 - 835
//

Text Mined References (19)

PMID Year Title
24842555 2014 The down-regulation of neuroligin-2 and the correlative clinical significance of serum GABA over-expression in Hirschsprung's disease.
24613359 2014 Calsyntenins function as synaptogenic adhesion molecules in concert with neurexins.
23751499 2013 The adhesion protein IgSF9b is coupled to neuroligin 2 via S-SCAM to promote inhibitory synapse development.
23248271 2013 MDGAs interact selectively with neuroligin-2 but not other neuroligins to regulate inhibitory synapse development.
22528485 2012 Transcellular neuroligin-2 interactions enhance insulin secretion and are integral to pancreatic ? cell function.
21551456 2011 Identification and functional characterization of rare mutations of the neuroligin-2 gene (NLGN2) associated with schizophrenia.
19926856 2009 The synaptic proteins neurexins and neuroligins are widely expressed in the vascular system and contribute to its functions.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18755801 2008 Expression of neurexin, neuroligin, and their cytoplasmic binding partners in the pancreatic beta-cells and the involvement of neuroligin in insulin secretion.
12669065 2003 Mutations of the X-linked genes encoding neuroligins NLGN3 and NLGN4 are associated with autism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10996085 2000 Synapse formation: if it looks like a duck and quacks like a duck ....
10892652 2000 Neuroligin expressed in nonneuronal cells triggers presynaptic development in contacting axons.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10767552 2000 The structure and expression of the human neuroligin-3 gene.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
9647694 1998 CIPP, a novel multivalent PDZ domain protein, selectively interacts with Kir4.0 family members, NMDA receptor subunits, neurexins, and neuroligins.
9278515 1997 Binding of neuroligins to PSD-95.
8576240 1996 Structures, alternative splicing, and neurexin binding of multiple neuroligins.