Property Summary

NCBI Gene PubMed Count 28
PubMed Score 246.49
PubTator Score 70.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4971 2.6e-09
malignant mesothelioma 3135 3.0e-07
glioblastoma 5635 5.5e-06
ependymoma 4559 5.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Mastitis 48 3.532 1.8
Kidney Failure 108 3.092 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 2.6e-09
ependymoma -1.100 5.6e-03
glioblastoma -1.200 5.5e-06
malignant mesothelioma 1.700 3.0e-07

Gene RIF (19)

AA Sequence

MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDE      1 - 70
RQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGFILTKDQPVTANMYFDSGNPA     71 - 140
PSTTSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRCIQAC    141 - 210
KTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRATELAVKLLQKRIEV    211 - 280
RVVRRKFKHTFGEDLVVCQIGMSSYEFPPALKPPEDLVVLGKDASGQPIFNASAKHWTNFVITENANDAI    281 - 350
GILNNSASFNKMSIEYKYEMMPNRTWRCRVFLQDHCLAEGYGTKKTSKHAAADEALKILQKTQPTYPSVK    351 - 420
SSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIA    421 - 490
EAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLR    491 - 560
KMGWTGGGLGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFSRELTN    561 - 630
DERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN              631 - 690
//

Text Mined References (34)

PMID Year Title