Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.98
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.5e-06
ovarian cancer 8520 3.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.478 3.5e-06
ovarian cancer 1.100 3.1e-04

 GO Component (2)

Gene RIF (4)

AA Sequence

MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQ      1 - 70
SYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLSERERIGEL     71 - 140
GAPEVWGLSPKNPEPDSDEHTPVEDEEPKKSTTSASTSEEEKKKKSSRSKERSKKRRKKKSSKRKHKKYS    141 - 210
EDSDSDSDSETDSSDEDNKRRAKKAKKKEKKKKHRSKKYKKKRSKKSRKESSDSSSKESQEEFLENPWKD    211 - 280
RTKAEEPSDLIGPEAPKTLTSQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECS    281 - 350
GYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK         351 - 415
//

Text Mined References (26)

PMID Year Title