Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.60
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.100 6.7e-05
astrocytic glioma -1.100 2.2e-02
atypical teratoid / rhabdoid tumor -1.600 2.2e-03
ependymoma -1.100 4.1e-02
glioblastoma -1.300 1.6e-04
group 3 medulloblastoma -1.200 2.3e-02
intraductal papillary-mucinous adenoma (... 1.200 6.2e-04
malignant mesothelioma -3.700 6.1e-08
medulloblastoma, large-cell -2.000 4.2e-05
oligodendroglioma -1.400 2.0e-02
osteosarcoma -1.919 1.5e-06
ovarian cancer -1.100 4.0e-06
primitive neuroectodermal tumor -1.800 1.9e-04
psoriasis -2.400 3.0e-04
spina bifida -1.216 3.7e-02
subependymal giant cell astrocytoma -2.204 6.2e-03
tuberculosis and treatment for 6 months -1.100 1.8e-03

Gene RIF (1)

AA Sequence

MDGSHSAALKLQQLPPTSSSSAVSEASFSYKENLIGALLAIFGHLVVSIALNLQKYCHIRLAGSKDPRAY      1 - 70
FKTKTWWLGLFLMLLGELGVFASYAFAPLSLIVPLSAVSVIASAIIGIIFIKEKWKPKDFLRRYVLSFVG     71 - 140
CGLAVVGTYLLVTFAPNSHEKMTGENVTRHLVSWPFLLYMLVEIILFCLLLYFYKEKNANNIVVILLLVA    141 - 210
LLGSMTVVTVKAVAGMLVLSIQGNLQLDYPIFYVMFVCMVATAVYQAAFLSQASQMYDSSLIASVGYILS    211 - 280
TTIAITAGAIFYLDFIGEDVLHICMFALGCLIAFLGVFLITRNRKKPIPFEPYISMDAMPGMQNMHDKGM    281 - 350
TVQPELKASFSYGALENNDNISEIYAPATLPVMQEEHGSRSASGVPYRVLEHTKKE                  351 - 406
//

Text Mined References (11)

PMID Year Title