Property Summary

NCBI Gene PubMed Count 35
PubMed Score 43.64
PubTator Score 38.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.400 5.3e-06
astrocytic glioma 1.400 9.5e-03
ependymoma 2.100 1.2e-03
oligodendroglioma 1.600 3.7e-03
psoriasis -2.400 5.5e-03
osteosarcoma -1.207 1.1e-02
primary pancreatic ductal adenocarcinoma 1.001 3.0e-02
breast carcinoma -1.100 1.0e-03
lung adenocarcinoma -1.100 4.7e-10
group 4 medulloblastoma 1.300 8.0e-03
acute myeloid leukemia -1.100 3.0e-02
lung carcinoma -1.700 2.4e-18
Breast cancer -1.100 6.8e-06
ductal carcinoma in situ -1.400 4.2e-03
invasive ductal carcinoma -2.800 7.0e-04
pituitary cancer -1.400 2.4e-03

 GWAS Trait (1)

Gene RIF (16)

PMID Text
26695693 Plasma miR-1914* and -1915 interact with NFIX RNA.
26653554 miR-1290 functions as a tumor oncogene in the progression of esophageal squamous cell carcinoma by targeting NFIX
26200704 Report novel mutations of NFIX gene causing Marshall-Smith syndrome or Sotos-like syndrome.
25220407 TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence.
25118028 NFIX analysis should be considered in patients presenting with overgrowth, macrocephaly and developmental delay including those in whom Sotos syndrome has been considered clinically but are negative for pathogenic NSD1 variants.
24924640 Deletions in the 3' part of the NFIX gene including a recurrent Alu-mediated deletion of exon 6 and 7 account for previously unexplained cases of Marshall-Smith syndrome.
22422452 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
22301465 missense mutations in NFIX were able to cause Sotos-like features.
21953450 NFI-X3 and STAT3 control the migration of differentiating astrocytes as well as migration and invasion of glioma cells via regulating YKL-40 expression.
21189253 NFI-X3 activates GFAP expression, in part, by inducing alterations in the nucleosome architecture that lead to the increased recruitment of RNA polymerase II
20673863 These findings demonstrate that allelic NFIX mutations trigger distinct phenotypes, depending specifically on their impact on nonsense-mediated mRNA decay.
20150379 Nuclear factor IA may play a role in astrocytoma biology.
19418463 an expression program of NFIs is executed during the differentiation of astrocytes, with NFI-X and -C controlling the expression of astrocytic markers at late stages of differentiation.
18754024 First report of structural alterations of the NFIA gene in hematopoietic diseases (polycythemia vera and chronic myelomonocytic leukemia, type 1).
16928756 temporal and dose-dependent interference by an AP-1 family member, c-Jun, upon NF-1 proteins binding an NF-1 consensus site derived from JC virus promoter sequence
16565071 NFI-X cooperates with (activator protein 1)AP-1 by an unknown mechanism in astrocytes, which results in the expression of a subset of astrocyte-specific genes.

AA Sequence

MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEIKQK      1 - 70
WASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKGI     71 - 140
PLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLAYFVHTPESGQSDSSNQQGDADIKPLPNGHL    141 - 210
SFQDCFVTSGVWNVTELVRVSQTPVATASGPNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKS    211 - 280
IDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHP    281 - 350
LPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPN    351 - 420
GSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRFVSIGPRDGNF    421 - 490
LNIPQQSQSWFL                                                              491 - 502
//

Text Mined References (40)

PMID Year Title
26695693 2016 The Plasma microRNA miR-1914* and -1915 Suppresses Chemoresistant in Colorectal Cancer Patients by Down-regulating NFIX.
26653554 2015 MiR-1290 promotes cancer progression by targeting nuclear factor I/X(NFIX) in esophageal squamous cell carcinoma (ESCC).
26200704 2015 Novel mutations of NFIX gene causing Marshall-Smith syndrome or Sotos-like syndrome: one gene, two phenotypes.
25416956 2014 A proteome-scale map of the human interactome network.
25220407 2014 TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25118028 2015 Malan syndrome: Sotos-like overgrowth with de novo NFIX sequence variants and deletions in six new patients and a review of the literature.
24924640 2014 Deletions in the 3' part of the NFIX gene including a recurrent Alu-mediated deletion of exon 6 and 7 account for previously unexplained cases of Marshall-Smith syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
22422452 2012 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
22301465 2012 Missense mutations in the DNA-binding/dimerization domain of NFIX cause Sotos-like features.
21953450 2011 A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40.
21189253 2011 The unique transcriptional activation domain of nuclear factor-I-X3 is critical to specifically induce marker gene expression in astrocytes.
20673863 2010 Distinct effects of allelic NFIX mutations on nonsense-mediated mRNA decay engender either a Sotos-like or a Marshall-Smith syndrome.
20150379 2010 Nuclear factor IA is expressed in astrocytomas and is associated with improved survival.
19706729 2009 Regulation of the CYP3A4 and CYP3A7 promoters by members of the nuclear factor I transcription factor family.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19418463 2009 Nuclear factor I isoforms regulate gene expression during the differentiation of human neural progenitors to astrocytes.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
18754024 2009 Alterations of NFIA in chronic malignant myeloid diseases.
16928756 2006 Interactions between c-Jun, nuclear factor 1, and JC virus promoter sequences: implications for viral tropism.
16565071 2006 Nuclear factor-1-X regulates astrocyte-specific expression of the alpha1-antichymotrypsin and glial fibrillary acidic protein genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12624117 2003 RFX1 and NF-1 associate with P sequences of the human growth hormone locus in pituitary chromatin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11068044 2000 Two nuclear localization signals are required for nuclear translocation of nuclear factor 1-A.
11046146 2000 Thyroglobulin repression of thyroid transcription factor 1 (TTF-1) gene expression is mediated by decreased DNA binding of nuclear factor I proteins which control constitutive TTF-1 expression.
10636857 2000 The histone-interacting domain of nuclear factor I activates simian virus 40 DNA replication in vivo.
9380514 1997 DNA binding and transcriptional activation by the Ski oncoprotein mediated by interaction with NFI.
9099724 1997 NFI-B3, a novel transcriptional repressor of the nuclear factor I family, is generated by alternative RNA processing.
9079676 1997 Identification of pirin, a novel highly conserved nuclear protein.
8799200 1996 Expression of multiple classes of the nuclear factor-1 family in the developing human brain: differential expression of two classes of NF-1 genes.
8340106 1993 Localisation of the human nuclear factor I/X (NFI/X) gene to chromosome 19p13 and detection of five other related loci at 1p21-22, 1q42-43, 5q15, 11p13 and 20q13 by FISH.
7937100 1994 Cloning and functional analysis of spliced isoforms of human nuclear factor I-X: interference with transcriptional activation by NFI/CTF in a cell-type specific manner.
7590749 1995 Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH.