Property Summary

NCBI Gene PubMed Count 45
PubMed Score 97.96
PubTator Score 56.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytic glioma 1.600 1.4e-02
atypical teratoid / rhabdoid tumor 1.100 2.5e-02
Breast cancer -2.600 4.8e-07
breast carcinoma -1.300 4.5e-04
cutaneous lupus erythematosus -1.100 1.3e-03
dermatomyositis 1.200 5.5e-04
ductal carcinoma in situ -1.100 1.3e-02
ependymoma 1.700 9.6e-03
gastric cancer 1.100 1.1e-03
group 3 medulloblastoma 1.900 2.8e-04
intraductal papillary-mucinous adenoma (... 1.300 7.1e-03
invasive ductal carcinoma -1.146 7.0e-03
lung adenocarcinoma -1.200 2.3e-06
lung cancer 1.300 1.8e-03
lung carcinoma -2.200 2.7e-17
malignant mesothelioma -1.200 5.0e-05
medulloblastoma, large-cell 1.200 1.4e-02
oligodendroglioma 1.500 7.1e-03
osteosarcoma 1.565 1.6e-02
ovarian cancer -2.600 9.5e-06
pancreatic cancer 1.100 3.1e-03
pancreatic carcinoma 1.100 3.1e-03
pediatric high grade glioma 1.200 2.0e-02
Pick disease 1.500 3.8e-05
pituitary cancer -2.200 5.5e-07
psoriasis -1.200 3.0e-07
urothelial carcinoma -1.100 1.9e-02

Protein-protein Interaction (3)

Gene RIF (33)

AA Sequence

MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQ      1 - 70
KWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKG     71 - 140
IPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQDSGQSGSPSHNDPAKNPPGYLED    141 - 210
SFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDEN    211 - 280
MEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV    281 - 350
AHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG    351 - 420
//

Text Mined References (51)

PMID Year Title