Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.14
PubTator Score 11.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma 1.600 5.1e-07
osteosarcoma -2.146 1.2e-05
glioblastoma 1.900 9.0e-03
group 4 medulloblastoma 2.400 2.1e-06
cystic fibrosis 2.856 9.4e-08
atypical teratoid / rhabdoid tumor 2.800 3.0e-05
medulloblastoma, large-cell 2.600 6.3e-06
primitive neuroectodermal tumor 1.400 1.5e-02
non-small cell lung cancer 1.436 5.7e-13
intraductal papillary-mucinous adenoma (... 1.300 2.1e-03
intraductal papillary-mucinous carcinoma... 2.200 9.8e-05
intraductal papillary-mucinous neoplasm ... 2.500 1.4e-03
colon cancer 1.500 2.3e-07
active Crohn's disease 1.552 3.3e-03
active ulcerative colitis 1.435 7.9e-03
sarcoidosis 1.600 4.4e-02
pancreatic cancer 1.800 9.2e-07
interstitial cystitis 1.200 1.6e-02
pediatric high grade glioma 1.400 1.3e-02
primary Sjogren syndrome 1.100 5.1e-03
lung adenocarcinoma 1.200 6.9e-05
nasopharyngeal carcinoma 1.800 6.4e-05
psoriasis 1.400 7.2e-15
ductal carcinoma in situ 1.200 2.0e-02
invasive ductal carcinoma 2.200 2.6e-02
ovarian cancer 1.200 8.7e-04
chronic rhinosinusitis 1.343 1.3e-02

Gene RIF (10)

PMID Text
26306035 findings reveal FBW7 and GSK3 as novel regulators of the NFE2L3 transcription factor and a potential mechanism by which FBW7 might regulate detoxification and the cellular response to stress
25130429 17beta-Estradiol treatment significantly increased but VC or Res decreased Nrf3 mRNA and protein expression levels.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17976382 Nrf3 is an N-glycosylated protein associated with the endoplasmic reticulum
15388789 NRF3 is highly expressed in primary placental cytotrophoblasts
15385560 Nrf3 is a negative regulator of ARE-mediated gene expression of NQO1

AA Sequence

MKHLKRWWSAGGGLLHLTLLLSLAGLRVDLDLYLLLPPPTLLQDELLFLGGPASSAYALSPFSASGGWGR      1 - 70
AGHLHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGSADEAHGLLGAAAASSTGGAG     71 - 140
ASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQVPDAGGCASEENGVLREKHEAVDHSSQHEE    141 - 210
NEERVSAQKENSLQQNDDDENKIAEKPDWEAEKTTESRNERHLNGTDTSFSLEDLFQLLSSQPENSLEGI    211 - 280
SLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTT    281 - 350
NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATEDNFDPIDVSQLFDEPDSDSG    351 - 420
LSLDSSHNNTSVIKSNSSHSVCDEGAIGYCTDHESSSHHDLEGAVGGYYPEPSKLCHLDQSDSDFHGDLT    421 - 490
FQHVFHNHTYHLQPTAPESTSEPFPWPGKSQKIRSRYLEDTDRNLSRDEQRAKALHIPFSVDEIVGMPVD    491 - 560
SFNSMLSRYYLTDLQVSLIRDIRRRGKNKVAAQNCRKRKLDIILNLEDDVCNLQAKKETLKREQAQCNKA    561 - 630
INIMKQKLHDLYHDIFSRLRDDQGRPVNPNHYALQCTHDGSILIVPKELVASGHKKETQKGKRK          631 - 694
//

Text Mined References (22)

PMID Year Title
26306035 2015 Stringent Control of NFE2L3 (Nuclear Factor, Erythroid 2-Like 3; NRF3) Protein Degradation by FBW7 (F-box/WD Repeat-containing Protein 7) and Glycogen Synthase Kinase 3 (GSK3).
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
25130429 2014 Natural antioxidants exhibit chemopreventive characteristics through the regulation of CNC b-Zip transcription factors in estrogen-induced breast carcinogenesis.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
23583978 2013 A meta-analysis identifies new loci associated with body mass index in individuals of African ancestry.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19047052 2009 The Nrf3 transcription factor is a membrane-bound glycoprotein targeted to the endoplasmic reticulum through its N-terminal homology box 1 sequence.
17976382 2007 Endoplasmic reticulum association and N-linked glycosylation of the human Nrf3 transcription factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388789 2005 Functional and placental expression analysis of the human NRF3 transcription factor.
15385560 2004 Nrf3 negatively regulates antioxidant-response element-mediated expression and antioxidant induction of NAD(P)H:quinone oxidoreductase1 gene.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11286316 2000 Expression of transcription factors during megakaryocytic differentiation of CD34+ cells from human cord blood induced by thrombopoietin.
10037736 1999 Molecular cloning and functional characterization of a new Cap'n' collar family transcription factor Nrf3.
9847074 1998 Toward a complete human genome sequence.