Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.08
PubTator Score 170.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.900 2.0e-08
ependymoma -1.600 3.7e-09
atypical teratoid / rhabdoid tumor -1.900 3.6e-11
medulloblastoma, large-cell -1.300 8.2e-05
primitive neuroectodermal tumor -1.300 2.8e-05
adult high grade glioma -1.700 1.8e-03
pilocytic astrocytoma -1.700 1.3e-05
sonic hedgehog group medulloblastoma -1.200 1.1e-02
lung carcinoma 2.500 2.0e-33

Gene RIF (4)

PMID Text
26276215 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
25124494 This is a novel gene implicated in atrial fibrillation
20847082 NEURL1 expression was downregulated in medulloblastoma compared to normal cerebellar tissue with lowest expression levels in hedgehog-activated tumors; conclude NEURL1 is candidate tumor suppressor in MB at least in part through effects on Notch pathway
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPATPLLFHPHTK      1 - 70
GSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPK     71 - 140
YACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLT    141 - 210
RGVQLLDSELVLPDCLRPRSFTALRRPSLRREADDARLSVSLCDLNVPGADGDEAAPAAGCPIPQNSLNS    211 - 280
QHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRSGGARP    281 - 350
GALSFGVTTCDPGTLRPADLPFSPEALVDRKEFWAVCRVPGPLHSGDILGLVVNADGELHLSHNGAAAGM    351 - 420
QLCVDASQPLWMLFGLHGTITQIRILGSTILAERGIPSLPCSPASTPTSPSALGSRLSDPLLSTCSSGPL    421 - 490
GSSAGGTAPNSPVSLPESPVTPGLGQWSDECTICYEHAVDTVIYTCGHMCLCYACGLRLKKALHACCPIC    491 - 560
RRPIKDIIKTYRSS                                                            561 - 574
//

Text Mined References (14)

PMID Year Title
26276215 2015 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
25124494 2014 Integrating genetic, transcriptional, and functional analyses to identify 5 novel genes for atrial fibrillation.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
20847082 2010 Neuralized1 causes apoptosis and downregulates Notch target genes in medulloblastoma.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213446 2002 Dendritic localization of mammalian neuralized mRNA encoding a protein with transcription repression activities.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11997106 2002 Cloning, chromosomal organization and expression analysis of Neurl, the mouse homolog of Drosophila melanogaster neuralized gene.
11585928 2001 Isolation of a murine homologue of the Drosophila neuralized gene, a gene required for axonemal integrity in spermatozoa and terminal maturation of the mammary gland.
9519875 1998 Identification of a human homolog of the Drosophila neuralized gene within the 10q25.1 malignant astrocytoma deletion region.